KEGG   Rattus norvegicus (rat): 289023
Entry
289023            CDS       T01003                                 

Gene name
Kiss1
Definition
(RefSeq) metastasis-suppressor KiSS-1 precursor
  KO
K23140  metastasis-suppressor KiSS-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    289023 (Kiss1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    289023 (Kiss1)
SSDB
Motif
Pfam: Kisspeptin
Other DBs
NCBI-GeneID: 289023
NCBI-ProteinID: NP_859043
RGD: 727850
Ensembl: ENSRNOG00000047481
Vega: OTTRNOG00000000632
UniProt: Q7TSB7 J7H5M8
Position
13
AA seq 130 aa
MISLASWQLLLLLCVASFGEPLAKMAPVVNPEPTGQQSGPQELVNAWQKGPRYAESKPGA
AGLRARRTSPCPPVENPTGHQRPPCATRSRLIPAPRGSVLVQREKDMSAYNWNSFGLRYG
RRQVARAARG
NT seq 393 nt   +upstreamnt  +downstreamnt
atgatctcgctggcttcttggcagctgctgcttctcctctgtgtggcctcttttggggag
ccactggcaaaaatggcacctgtggtgaaccctgaacccacaggccaacagtccggaccc
caggaactcgttaatgcctggcaaaagggcccgcggtatgcagagagcaagcctggggct
gcaggactgcgcgctcgccgaacatcgccatgcccgccggtggagaaccccacggggcac
cagcggcccccgtgtgccacccgcagtcgcctgatccctgcgccccgcggatcggtgctg
gtgcagcgcgagaaggacatgtcagcctacaactggaactcctttggcctgcgctacggc
aggaggcaggtggcgcgggcggcacggggctga

DBGET integrated database retrieval system