KEGG   Rattus norvegicus (rat): 289026Help
Entry
289026            CDS       T01003                                 

Gene name
Sox13
Definition
(RefSeq) SRY box 13
  KO
K09269  transcription factor SOX5/6/13 (SOX group D)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    289026 (Sox13)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    289026 (Sox13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box HMG_box_2 AAA_23
Motif
Other DBs
NCBI-GeneID: 289026
NCBI-ProteinID: NP_001099422
RGD: 1309674
Ensembl: ENSRNOG00000028353
Vega: OTTRNOG00000000634
UniProt: D4A8S0
Position
13q13
AA seq 612 aa AA seqDB search
MSVQSPVSVQLAPDSASTMVNCTVKSEEKKEPCHEAPQGTATAVEPQPGDPALASQDATN
SKAPAQDCASPQSSGSPDPKRPAASEAASGSQERLDFNRNLQEVVPAIEKLLSSDWKERF
LGRSSVEAKDVKGTQESLAEKELQLLVMIHQLSALRDQLLTAHSEQKNMAAMLFEKQQQQ
MELARQQQEQIAKQQQQLIQQQHKINLLQQQIQVNMPYVMIPAFPSSHQPLPVTPDSQLA
LPIQPIPCKPVEYPLQLLHSPPAPVVKRPGVATHHPLQEPPQPLNLTAKPKVSELPNTSS
SPSLKMNSCGPRPSSHGAPTRDLQSSPPNLPLGFLGEGDAVTKAIQDARQLLHSHSGALE
NSPSAPFRKDLISLDSSPAKERLEENCVHPLEEAMLGCDVDGSRHFSESRNSSHIKRPMN
AFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQHLEKYP
DYKYKPRPKRTCVVEGRRLRVGEYKALMRTRRQGARQSYAIPPQAGQAQVSSDILFPRAA
GMPLARPLVEHYDPQGLDPNMPVIINTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGD
EKSEEELVVLTD
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcagagccccgtctctgtgcagctggccccagacagcgctagcaccatggtg
aactgcaccgtcaagtctgaggagaagaaggagccttgccacgaagctccccaaggcaca
gccactgcagtggagccccagcctggagacccagccctggcctctcaggatgccaccaac
tccaaagcccctgctcaggactgtgcctcaccacagagcagtgggtccccagaccccaag
agaccagcagcttccgaggctgcttcgggaagccaggagcggctggacttcaaccgcaac
ttacaggaagttgttccagccattgagaagctgctgtccagtgactggaaggagaggttt
ctgggaagaagctctgtggaagctaaggatgtcaaagggacccaagagagcctggctgag
aaggagctccagcttctggtcatgatccatcagctctccgcccttcgggaccagctcctt
acggcccactctgagcagaagaacatggctgccatgctgtttgagaaacagcagcagcag
atggaactggccaggcagcagcaggagcagatcgccaagcaacagcagcagctgattcag
cagcagcacaagatcaacctcctccagcagcagatccaggttaacatgccttatgtcatg
atcccggcctttccctcaagtcaccagcctttgcctgtcactcctgactcccagctggct
ttgcccattcagcccattccctgcaagccagtggagtacccactgcagctgctgcacagc
ccgcctgcccccgtggtgaagaggcctggggtggccacccaccaccccctgcaggagccc
ccacaaccactgaacctcacagccaagcccaaggtctctgagctacccaacacctccagc
tctcccagcctgaagatgaacagttgtgggcctcgcccctccagccatggggctcccaca
agggatctgcagtccagccccccgaacctgcctctgggcttccttggggaaggggacgct
gtcaccaaagccatccaggatgctcggcaactgctacacagccacagtggggccttggaa
aactcccccagtgccccattccgaaaggacctcatcagcctggactcctccccagccaag
gagcggctggaggagaactgtgtgcatcccctggaggaagccatgctgggctgtgacgtg
gatggctctcgccatttctccgagtctcggaacagcagccacatcaagagacccatgaat
gccttcatggtgtgggccaaggatgagcggaggaaaattcttcaagccttcccagatatg
cataactccagcatcagcaagatccttggttctcgctggaagtccatgaccaaccaggag
aagcagccgtactacgaggagcaggcccgtctgagccgacagcacctggagaaatatccc
gactacaagtacaagccaaggcctaaacgcacctgtgtcgtggagggccggcggctgcga
gtgggcgagtacaaagccctgatgaggacacggcgccagggtgctcgccaaagctacgcc
atccccccgcaggctggccaggcacaggtgagctcagatatcctgttccctcgggcagca
ggcatgcccttggcacgtccactggtggagcactatgacccccagggcctggaccccaac
atgcctgtcatcatcaatacctgcagtctccgggaggaaggggagggcacagatgacagg
cactcggtggccgatggagagatgtaccggtacagcgaggatgaggactcagagggtgac
gagaagagtgaggaggagctggtggtactcacagactga

DBGET integrated database retrieval system