KEGG   Rattus norvegicus (rat): 289032Help
Entry
289032            CDS       T01003                                 

Gene name
Chit1
Definition
(RefSeq) chitinase 1
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00520  Amino sugar and nucleotide sugar metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    289032 (Chit1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     289032 (Chit1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_18 CBM_14
Motif
Other DBs
NCBI-GeneID: 289032
NCBI-ProteinID: NP_001073157
RGD: 1305646
Ensembl: ENSRNOG00000028072
UniProt: A0S5V8
Position
13q13
AA seq 464 aa AA seqDB search
MVQSLALAGVTTLLMIQWGSAAKLFCYFTNWAQYRSGAARFLPRDVDPNLCTHVIYAFAG
LNNHQVSTVEPNDELFYQELNSLKKRNPKLKTLLAVGGWSFGTQKFTDMVATASTRQTFV
NSALSFLRTHGFDGLDLDWEYPGSRGSPAVDKERFTALIQDLAKAFQEEARASGKSRLLL
TAAVPTGRGHVDAGYEVDKIVQSLDFINLMAYDFHSSWDKTTGHNSPLYKRQGETGKDAE
KNVDAAVTLWLQKGTPASKLMLGMPAYGRSFTLASSSDSGVGAPATGPGAPGPYTKEKGI
LVYFEVCSWKGKQRIEDQKVPYVSQGNQWVGFDDRESFRAKAAYVKQKGLGGAMVWILDG
DDFKGSFCNEGQYPLIRTLHQELSLSSGPPRSPEQEVPGPHQPSEPEQGPSPGLDDFCQG
KADGLYPNPTEKSSFYSCGGGRLFQHSCPPGLVFIDSCKCCTWG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagtccctggccttggcaggtgtgacgactctgctgatgatccagtggggctct
gctgcaaaactgttctgctacttcaccaactgggcccagtaccggtccggggcagctcga
ttcctacctagggatgtggatcccaacctgtgtacccatgtcatctatgcctttgctgga
ctgaacaaccaccaggtcagcactgtagagcccaatgacgagcttttctaccaagagctg
aacagcctaaagaagaggaaccccaagctcaagaccctgttagccgtcgggggctggagc
tttggtacccagaagttcacagacatggtggccacagccagcacccggcagacctttgtc
aactcagctctctcgttcctgcgcactcatggttttgacggccttgaccttgactgggaa
tacccaggaagccgagggagcccagcagtagacaaagagagattcacagcgctgatacag
gatttggccaaagccttccaggaggaagcccgggcctcagggaaaagtcgcctccttctg
actgcagctgtaccaactggtcgaggccatgtggatgctggttatgaggtggacaagatt
gttcagagtttggatttcatcaaccttatggcctacgacttccacagctcctgggacaag
accacagggcacaacagccccctctacaaaaggcaaggagagactgggaaagatgctgaa
aaaaatgtggatgctgctgtgacgctctggctgcagaaggggacccctgccagcaaactg
atgcttggcatgcccgcctacggacgctccttcaccttggcctcctcatcagacagtgga
gttggggctccagccacaggacctggggccccaggcccctatactaaggaaaaggggata
ctggtttactttgaggtctgctcctggaagggaaaacagagaatcgaggaccagaaggtg
ccctatgtctcccagggcaaccaatgggtgggatttgatgacagggaaagcttcagagcc
aaggctgcctatgtgaaacagaagggactgggaggggccatggtctggattctggatggg
gatgacttcaaaggttccttctgcaacgagggccagtaccctctcatccggacactacac
caggagctgagcctttcatccgggcctccaagaagcccagaacaggaagtacctgggcca
caccagccttctgagcccgagcagggccccagcccagggctagatgacttctgccaaggc
aaagctgatgggctctaccccaaccctacagaaaagtccagtttctacagctgtggaggg
gggcgactgttccagcacagctgccccccaggcctggtgtttatcgactcttgcaaatgc
tgtacctggggttga

DBGET integrated database retrieval system