KEGG   Rattus norvegicus (rat): 289036
Entry
289036            CDS       T01003                                 

Gene name
Adipor1
Definition
(RefSeq) adiponectin receptor 1
  KO
K07297  adiponectin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04920  Adipocytokine signaling pathway
rno04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    289036 (Adipor1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    289036 (Adipor1)
  09149 Aging
   04211 Longevity regulating pathway
    289036 (Adipor1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    289036 (Adipor1)
SSDB
Motif
Pfam: HlyIII DUF962 DUF4405
Other DBs
NCBI-GeneID: 289036
NCBI-ProteinID: NP_997470
RGD: 1303151
Ensembl: ENSRNOG00000004143
UniProt: Q6P746
Position
13q13
AA seq 375 aa
MSSHKGSAVAQGNGAPSSNREADTVELAELGPLLEEKGKRAATSPAKAEEEQACPVPQEE
EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE
FRYGLEGGCTDDSLL
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtcttcccacaaaggatctgccgtggcccagggcaatggggctccttctagtaacaga
gaagcggacacggtggagctggctgagctggggcccctgctggaggagaagggtaagcgg
gcagccaccagcccagccaaggctgaagaagaacaagcatgccccgtgcctcaggaggag
gaggaggaggtgcgggtgctgacccttcctctgcaagcccaccatgccatggagaagatg
gaggagttcgtatataaggtctgggaggggcgttggagggtcatcccatacgatgtgctt
cctgactggctgaaagacaatgactacctgctacatggccacagaccacctatgccctcc
ttccgggcttgcttcaagagcatcttccgcatccacacagaaactggcaacatctggaca
catttgcttggttttgtgctatttctctttctgggaatcttgaccatgctcagaccaaat
atgtacttcatggctcccctccaggagaaggtggtcttcgggatgttcttcctgggtgca
gtgctctgcctcagcttctcctggcttttccacaccgtctactgtcattcagagaaggtc
tctcgcactttttccaaactggactattcagggattgctctactgattatggggagcttc
gtcccctggctctattactccttctactgctccccacagccacggctcatctacctctcc
atcgtctgtgtcctgggcatctctgccatcattgtggcacagtgggaccggtttgccact
cccaagcaccggcagacaagagcaggagtgttcctgggacttggcttgagtggtgttgta
cccaccatgcactttactatcgctgagggctttgtcaaggccaccacagtgggccagatg
ggctggttcttcctcatggctgtgatgtacatcaccggcgctggcctttatgctgctcgg
attcctgagcgcttctttcctggaaaatttgacatatggttccagtctcatcagattttc
catgtcctggtggtggcagcggctttcgtccacttctatggggtgtccaacctacaggaa
ttccgttacggcctagagggtggatgtaccgatgactcccttctctga

DBGET integrated database retrieval system