KEGG   Rattus norvegicus (rat): 289038
Entry
289038            CDS       T01003                                 

Gene name
Mgat4e, RGD1308112
Definition
(RefSeq) MGAT4 family, member E
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Glyco_transf_54
Other DBs
NCBI-GeneID: 289038
NCBI-ProteinID: XP_006221537
RGD: 1308112
Ensembl: ENSRNOG00000039568
UniProt: D3ZJ23
Position
13q13
AA seq 448 aa
MRCFIRHFFRVSVALMVLWFLIVLHVPEENKDVKTMVIKHGSKNSKSLNSWQSITSKYLK
EIHQRRKTWLTVGITSESGHGQNGLLDTLASLYHASSTSEQRQMTVLVHLADSDPTWLKR
TIFRISSLYRSQILTGQLLLIHAPPDAYPTVSNVQKEISQGQIYSKQNVDHAFLMSFATK
LSPYFLLIEDDVFCAPNFVDHIRSKVIGRKPNTWVLLEFSNMGILGKLLHSKDLPLLTRF
LLLFHKERPLDWLIRHFCTLLAQQSPILYRPFLFYHRLTHSTFTNNVTDQEQDLPCPDSL
TGTVFTDMRFSDVHSPQAAYTLDESFFWSYNVSTGNYLILILNNPANLDRVQVRTGSIMD
GKYILEKGQVELGYEPEGTPPNCTSFTLLGHLVQGQMDQIILKSAGSEVSCVKLAVNANQ
VGGLMVRHIYIWGENAEVRRNNQRYDKW
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgcgctgtttcatcagacatttcttcagagtctctgtggccctcatggtcctgtggttc
ctcatcgtcctgcacgtcccagaggaaaacaaagatgtcaaaactatggtgatcaagcat
ggcagtaagaactccaaatcactaaacagctggcagagcatcacttccaagtacctgaaa
gaaatccatcagagaagaaagacatggttgacagtggggatcacctcagagtcaggacac
ggtcaaaatggcctcctggataccctggcctccctgtaccacgcctcctccacgtctgag
cagagacaaatgactgtgctggtccacctggccgactctgaccccacctggctcaagaga
actatcttccgcatttcaagtctctacaggtcccagattttgacagggcaattactactg
atccatgccccacctgatgcctaccccactgtgtctaatgtccagaaggagatctctcag
gggcagatctactccaagcagaatgtagatcacgctttcctcatgagctttgctacaaag
ctctccccttacttcctgttgatagaggacgatgtcttttgtgcccccaattttgtcgac
cacattcgctcaaaggtgatcggcaggaagcccaacacatgggtgctcctggagttctct
aatatgggcatcctgggtaaacttctccacagcaaggaccttccactcctgacccgtttc
ctcctcctcttccacaaggagcgacctctcgactggctgatccgtcatttctgtaccctc
ttggcccagcaaagtccaatcctctacagaccctttctcttctaccataggttgactcac
tccactttcacaaacaacgtaacagaccaggaacaagatcttccttgtcccgatagcctc
actggaactgttttcacagacatgaggttctctgatgttcattccccgcaggcggcctac
actctggacgagtctttcttttggtcctacaatgtcagtacagggaactacttgatcttg
attttgaacaatccagcgaacctcgacagagtgcaagtaagaacaggctccatcatggat
ggaaagtacatcctagagaaaggacaggtggaactaggctacgagcctgagggaacgccc
ccgaactgcaccagctttaccctgcttggccatcttgtgcaggggcagatggatcagatc
atcctgaaaagcgctgggtctgaagtaagctgcgtgaagctggcagtgaacgctaatcag
gtcggtggtctcatggtcaggcatatctacatctggggggagaatgccgaagtcagaaga
aataatcaaagatatgataagtggtga

DBGET integrated database retrieval system