KEGG   Rattus norvegicus (rat): 289046
Entry
289046            CDS       T01003                                 

Gene name
Tmem9
Definition
(RefSeq) transmembrane protein 9
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 289046
NCBI-ProteinID: NP_001099423
RGD: 1307922
Ensembl: ENSRNOG00000010204
UniProt: B5DFJ7
Position
13q13
AA seq 183 aa
MKLLCLVAVVGCLLVPPAQANKSSEDIRCKCICPPYRNISGHIYNQNVSQKDCNCLHVVE
PMPVPGHDVEAYCLLCECRYEERSTTTIKVIIVIYLSVVGALLLYMAFLMLVDPLIRKPD
AYTEQLHNEEENEDARSMAAAAASIGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHK
MLS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaagctgctgtgtttggtggctgtggtggggtgcttgctggtacccccggctcaagcc
aacaagagctctgaagatatccggtgcaaatgcatctgtcccccttacagaaacatcagc
gggcacatttacaaccagaatgtgtctcagaaggactgcaactgcctgcatgtggtggag
cccatgccggtgcctggccatgatgtggaagcctactgcctgctctgtgagtgtaggtat
gaggagcgcagcaccacaaccatcaaggtcattatcgtcatctacctgtctgtggtaggg
gccctcttactctacatggccttcctgatgctggtggaccctctcatccgaaagccggat
gcctatactgagcagctgcacaatgaagaagagaatgaggatgcccgctccatggctgcc
gccgccgcatccattggaggaccccgagcaaacaccgtcctggagcgggtggaaggcgct
cagcagcgatggaagctacaggtgcaggagcagcggaagacggtcttcgatcgacacaag
atgctcagttag

DBGET integrated database retrieval system