KEGG   Rattus norvegicus (rat): 289051
Entry
289051            CDS       T01003                                 

Gene name
Dennd1b, Fam31b
Definition
(RefSeq) DENN domain containing 1B
  KO
K20160  DENN domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    289051 (Dennd1b)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    289051 (Dennd1b)
SSDB
Motif
Pfam: DENN uDENN dDENN
Other DBs
NCBI-GeneID: 289051
NCBI-ProteinID: XP_003751292
RGD: 1308441
Ensembl: ENSRNOG00000011063
UniProt: D3Z8F6
Position
13q13
AA seq 760 aa
MDRRTRENPERTFDLVLKVKCHASENEDPVVLWKFPEDFGDQEVLQSVPRFCFPFDVERV
SQNQVGQHFTFVLTDMESKQRFGFCRLTSGGRVCLCILSYLPWFEVYYKLLNTLADYLAK
ELEDDLNETLKSLYSHPVPKANTPVHLSVHSCFITPDITGLPTIPESRNLTEYFVAVDVN
NMLRLYASMLHERRIIITSSKLSTLTACLHGSAALLYPMYWQHIYIPVLPPHLLDYCCAP
MPYLIGIHSSLIERVKNKSLEDVVMLNVDTNTLESPFNDVNSLPSDVVSALKNKLKKQST
ATGDGVARAFLRAQAALFGSYRDALRYKPGEPITFCEESFVKHRSSVMKQFLETAVNLQL
FKQFIDGRLAKLNAGRGFSDIFEEEITSGGFCGGSPRSYQQWVYTVKKGGALFNTAVTKA
TPAVRTAYKFAKSHARLGLKEVKSRLRHKDNEEDYGTCSGLVQYTPVYTLHHERGETREK
QKLSQAHLKRPHKSLDGTLYDDDDDIERASKISSEDGEETSAYFYESDDSVDAQVKAPYS
GEMDLLGEILDTLSTHSSDQGKLAPAKSLDFFRSMDDIDYKPTNKSNAPSENNLTLLCAS
GDQGEWNLGQDDSALHGKHLPPSPRKRVCSSGLTDSLFILKEENTEKPFSADSVSVPTVV
EKSASTSDSGFQPATPEASQTHKGKPEVKQTLSQASDDLLVPSPGNRQSTFVPWEKAGKE
ETKPSKDVGLLQEVVSLCHMSCDFQQGLNISEESKSENQT
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggaccgcaggaccagggaaaatccagaaagaactttcgacttggtattaaaagtgaag
tgtcatgcctctgaaaatgaagatcctgtggtattgtggaaattcccagaggactttgga
gatcaggaagttctgcagagtgtgcccaggttctgttttcccttcgatgtggaaagggtg
tctcagaatcaagttggacagcactttaccttcgtcctgacagacatggaaagtaagcaa
cgatttgggttctgcaggctcacatctggaggcagagtttgtttgtgtattcttagttac
ttgccatggtttgaagtgtattataaacttctaaatactctggcagattacttggccaag
gaactggaagatgatttgaatgaaactcttaaatcactctatagccacccagtaccgaag
gcaaatactcccgtccacttgagtgtgcactcctgtttcatcacaccggacataactgga
cttccaaccatcccggagagtagaaacctgacggagtacttcgtagctgtggatgtgaac
aacatgctgcggttgtacgccagcatgctgcacgagaggcgcatcattattacctcgagc
aaattaagcactttaactgcctgtctccatggatcggccgctctgctctacccgatgtac
tggcaacacatatatatccctgtgcttcctccacacctgctggactactgctgtgcccca
atgccatacctgattggaatacactccagtctcatagagagagtgaaaaataaatcattg
gaagatgtggttatgttaaatgttgacacaaacacattagaatcaccatttaatgacgtg
aacagcctgcccagtgatgtggtctcggccttgaaaaataagctgaagaagcagtccaca
gctacgggagatggagtggctcgggcctttctgagggcgcaggcagctttgtttggctcc
taccgagatgctctgagatacaagcctggcgagcccatcaccttctgtgaggagagcttt
gtaaagcaccgctcaagtgtgatgaaacaattcctggagactgcagttaaccttcagctg
tttaagcagtttattgacggtcgactggcaaaactcaatgcaggaagaggtttctctgat
atattcgaagaggagatcacttcaggtggcttctgtggagggagcccgcggtcatatcaa
cagtgggtgtatacagtcaagaaaggaggtgcattgttcaacacagcagtgaccaaagcg
actcctgctgtgcggacagcctacaaatttgcaaagagtcacgccagactgggtctgaag
gaggtgaagagcagactgagacacaaggacaatgaggaggattatgggacctgttctggt
ttggtacagtacacaccagtatacaccttgcaccatgaaaggggagaaaccagagagaag
cagaagctttcccaggcacacttgaaaaggccccataagagcctcgacggcaccctgtat
gatgatgatgatgacatcgaaagggcaagcaagatatcttctgaagacggtgaagaaaca
tctgcctatttctatgagagcgacgactctgttgatgcacaggtgaaggctccttactca
ggtgagatggatttactgggcgagatcctggacacgctgagcacacacagctctgaccaa
ggaaagctggcacccgccaagagcctggatttcttcagatccatggacgacattgactac
aagcccacgaacaagtccaacgctcccagtgagaataacctgaccctactgtgtgcttct
ggcgatcagggagagtggaatctcgggcaggatgacagcgccctccatggcaagcacctc
cctccatcccccaggaaaagagtttgctccagtgggttgacagattccctatttatcttg
aaagaggagaacactgagaagcccttcagtgctgacagtgtaagtgtccctactgtggtg
gaaaagtccgcttctacttcagattccggtttccagccagccactcctgaagcttctcag
acgcataaaggaaaaccagaggtgaagcaaacactaagtcaagcttcagatgatctgctg
gtacccagccctgggaaccgccagtctacttttgttccctgggaaaaagctgggaaagag
gagacgaagccttcaaaagatgttggacttctccaagaagtagtgtcattgtgtcacatg
tcatgtgacttccaacaaggtttaaacatttcagaagaaagcaaaagtgaaaaccaaact
taa

DBGET integrated database retrieval system