KEGG   Rattus norvegicus (rat): 289055
Entry
289055            CDS       T01003                                 

Gene name
F13b
Definition
(RefSeq) coagulation factor XIII B chain
  KO
K03906  coagulation factor XIII B polypeptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    289055 (F13b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    289055 (F13b)
SSDB
Motif
Pfam: Sushi Sushi_2
Other DBs
NCBI-GeneID: 289055
NCBI-ProteinID: NP_001099426
RGD: 1311668
Ensembl: ENSRNOG00000012613
UniProt: A0A0G2KAS2
Position
13q13
AA seq 599 aa
MRPRHLPFILILIISGELYAEEKQCDFPAVENGRIAQYYYTFKSYYFPMSIDKKLSFFCL
AGYATESGKQEEKIRCTAEGWSPKPRCYKKCLKPVLRNGYVSDGKVLYKIQENMRYGCTS
GYKTTGGKDEEVVQCLSEGWSSQPSCRKEQETCLAPELHHGNYSTIQRTFKVKDRVQYTC
TAGYYTATGKQTEEVECQAHGWSFTPQCNKLMCSSLRLIENGYFHPVKQTYEEGDVVQFF
CHENYYLSGSDLIQCYNFGWYPESPICEGRRNRCPPPPVPLNSKVEPHSTTYRHGEVVHI
ECELNFAIQGSDALVCENGKWTEPPKCVENIENCKPPPVIANGAVVDDLLASYTTGSSVE
YRCNEYYLLKGSQTSLCEQGTWSSPPVCLEPCTIDVHHMNRNNIQMKWKYEGKILHGDMI
DFVCKQGYVLPLSTTLSEVSVQCNRGDVRYPVCVRRESKGMCASPPVIRNGNIVSLVAST
YENGSSVEYQCFDSHFLQGSRDAYCVDGVWTTPPSCLEPCTLSFVEMDKNYLQLKWNFDN
RPLILHGEYIEFICKGDAYMTETSIPESELRVQCDGGILKYPKCTPRERSLSFQEALRT
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgaggccgagacacttgccatttattcttatattaatcatctcaggagaactctatgca
gaagagaaacagtgtgattttcctgccgtggaaaatggaagaattgcccaatattattat
acgtttaaaagctattacttccccatgagcatagacaaaaaactatcattcttctgtttg
gctggctatgcaaccgaaagtgggaagcaagaagagaaaatcaggtgtacagcggaaggc
tggtctccaaaaccaaggtgctacaaaaaatgcctgaagcctgtcttaaggaatggctat
gtctctgatggcaaagtactatacaaaattcaagagaatatgcgttacggttgcacttca
ggatacaaaacgactgggggaaaggatgaagaagtggtccagtgtctttctgaagggtgg
tcttctcaaccgtcctgcaggaaagaacaagagacatgtttggcccctgagttgcatcat
gggaattattccacgatacagaggacattcaaagtgaaggacagagtgcagtacacatgc
actgcaggctactacaccgccacagggaagcagactgaggaagtggagtgccaggctcat
ggctggtccttcacgccacagtgcaacaaattaatgtgctcttctttgagattaatagaa
aatggctattttcatcctgtaaagcaaacctatgaagaaggagatgtagttcaatttttc
tgtcatgaaaattattacctaagtggatctgatttaattcagtgctataactttggctgg
tatccagaatcgcccatatgtgaaggaagaagaaatcgatgccctcctccacctgtgcct
ctaaattctaaagttgaaccgcattcaacaacttaccgtcacggagaagtagttcatata
gaatgtgagcttaattttgcgatccagggttcagatgcactagtctgtgaaaatgggaag
tggacggaacctccaaaatgtgttgaaaatattgagaattgtaagcctcctcctgttata
gccaatggtgcagttgttgatgatttactggcaagttacacaacaggatcttcggtggaa
tacagatgcaatgagtattacttattgaagggatcgcaaacatctctctgtgagcaagga
acatggtcatcgccacctgtctgcttggagccatgcactattgatgtgcatcacatgaac
aggaataacatacagatgaagtggaaatatgagggcaagattttacatggagacatgata
gattttgtgtgtaaacaaggctatgttttgccactgtcgaccaccctgtctgaagtgtct
gtgcagtgcaatagaggagatgtgaggtaccctgtgtgtgtgagaagagaatctaaaggg
atgtgtgcatctcctccagtgataagaaatgggaacattgttagcttagtagccagcacc
tatgaaaatggctcgtcagtagagtaccagtgctttgatagccatttcctacaagggtca
cgggatgcctactgtgtagatggagtgtggactacaccaccatcttgtttagagccttgc
acattatcatttgttgaaatggataagaactatttacagctgaaatggaattttgacaac
agaccgctcattctccatggcgagtatattgaatttatttgcaagggagatgcatatatg
actgagacatctattcctgagtctgaacttcgagtgcagtgtgacgggggaatactgaaa
taccctaagtgtactccaagagaaaggagtctgtcctttcaggaagcattaaggacctga

DBGET integrated database retrieval system