KEGG   Rattus norvegicus (rat): 289055
Entry
289055            CDS       T01003                                 

Gene name
F13b
Definition
(RefSeq) coagulation factor XIII B chain precursor
  KO
K03906  coagulation factor XIII B polypeptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    289055 (F13b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    289055 (F13b)
SSDB
Motif
Pfam: Sushi Sushi_2
Other DBs
NCBI-GeneID: 289055
NCBI-ProteinID: NP_001099426
RGD: 1311668
Ensembl: ENSRNOG00000012613
UniProt: A0A0G2KAS2
Position
13
AA seq 599 aa
MRPRHLPFILILIISGELYAEEKQCDFPAVENGRIAQYYYTFKSYYFPMSIDKKLSFFCL
AGYATESGKQEEKIRCTAEGWSPKPRCYKKCLKPVLRNGYVSDGKVLYKIQENMRYGCTS
GYKTTGGKDEEVVQCLSEGWSSQPSCRKEQETCLAPELHHGNYSTIQRTFKVKDRVQYTC
TAGYYTATGKQTEEVECQAHGWSFTPQCNKLMCSSLRLIENGYFHPVKQTYEEGDVVQFF
CHENYYLSGSDLIQCYNFGWYPESPICEGRRNRCPPPPVPLNSKVEPHSTTYRHGEVVHI
ECELNFAIQGSDALVCENGKWTEPPKCVENIENCKPPPVIANGAVVDDLLASYTTGSSVE
YRCNEYYLLKGSQTSLCEQGTWSSPPVCLEPCTIDVHHMNRNNIQMKWKYEGKILHGDMI
DFVCKQGYVLPLSTTLSEVSVQCNRGDVRYPVCVRRESKGMCASPPVIRNGNIVSLVAST
YENGSSVEYQCFDSHFLQGSRDAYCVDGVWTTPPSCLEPCTLSFVEMDKNYLQLKWNFDN
RPLILHGEYIEFICKGDAYMTETSIPESELRVQCDGGILKYPKCTPRERSLSFQEALRT
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgaggccgagacacttgccatttattcttatattaatcatctcaggagaactctatgca
gaagagaaacagtgtgattttcctgccgtggaaaatggaagaattgcccaatattattat
acgtttaaaagctattacttccccatgagcatagacaaaaaactatcattcttctgtttg
gctggctatgcaaccgaaagtgggaagcaagaagagaaaatcaggtgtacagcggaaggc
tggtctccaaaaccaaggtgctacaaaaaatgcctgaagcctgtcttaaggaatggctat
gtctctgatggcaaagtactatacaaaattcaagagaatatgcgttacggttgcacttca
ggatacaaaacgactgggggaaaggatgaagaagtggtccagtgtctttctgaagggtgg
tcttctcaaccgtcctgcaggaaagaacaagagacatgtttggcccctgagttgcatcat
gggaattattccacgatacagaggacattcaaagtgaaggacagagtgcagtacacatgc
actgcaggctactacaccgccacagggaagcagactgaggaagtggagtgccaggctcat
ggctggtccttcacgccacagtgcaacaaattaatgtgctcttctttgagattaatagaa
aatggctattttcatcctgtaaagcaaacctatgaagaaggagatgtagttcaatttttc
tgtcatgaaaattattacctaagtggatctgatttaattcagtgctataactttggctgg
tatccagaatcgcccatatgtgaaggaagaagaaatcgatgccctcctccacctgtgcct
ctaaattctaaagttgaaccgcattcaacaacttaccgtcacggagaagtagttcatata
gaatgtgagcttaattttgcgatccagggttcagatgcactagtctgtgaaaatgggaag
tggacggaacctccaaaatgtgttgaaaatattgagaattgtaagcctcctcctgttata
gccaatggtgcagttgttgatgatttactggcaagttacacaacaggatcttcggtggaa
tacagatgcaatgagtattacttattgaagggatcgcaaacatctctctgtgagcaagga
acatggtcatcgccacctgtctgcttggagccatgcactattgatgtgcatcacatgaac
aggaataacatacagatgaagtggaaatatgagggcaagattttacatggagacatgata
gattttgtgtgtaaacaaggctatgttttgccactgtcgaccaccctgtctgaagtgtct
gtgcagtgcaatagaggagatgtgaggtaccctgtgtgtgtgagaagagaatctaaaggg
atgtgtgcatctcctccagtgataagaaatgggaacattgttagcttagtagccagcacc
tatgaaaatggctcgtcagtagagtaccagtgctttgatagccatttcctacaagggtca
cgggatgcctactgtgtagatggagtgtggactacaccaccatcttgtttagagccttgc
acattatcatttgttgaaatggataagaactatttacagctgaaatggaattttgacaac
agaccgctcattctccatggcgagtatattgaatttatttgcaagggagatgcatatatg
actgagacatctattcctgagtctgaacttcgagtgcagtgtgacgggggaatactgaaa
taccctaagtgtactccaagagaaaggagtctgtcctttcaggaagcattaaggacctga

KEGG   Rattus norvegicus (rat): 60327
Entry
60327             CDS       T01003                                 

Gene name
F13a1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    60327 (F13a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    60327 (F13a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     60327 (F13a1)
SSDB
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Other DBs
NCBI-GeneID: 60327
NCBI-ProteinID: NP_067730
RGD: 621495
Ensembl: ENSRNOG00000015957
UniProt: O08619 G3V811
Position
17
AA seq 732 aa
MSDTPATTFGGRRAIPPNNSNAAEVDLPTEDLQGLVPRGVSLKDYLNVTAVHLFKERWDS
NKIDHHTDKYDNNKLIVRRGQTFYIQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPV
PVVTELQSGKWGAKVIMNEDRSVRLSVQSSPECIVGKFRMYVAVWTPYGILRTQRDPETD
TYILFNPWCEEDAVYLDDEKEREEYVLNDIGVIFHGDFNDIKSRSWSYGQFEDGILDACL
YVMDKAEMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYAYGIPPSAWTGSVDIL
LEYRSSETPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGS
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLVYITAKKDGTHVVENVDATHIGKLIVTKEIGGDGMQDITD
TYKFQEGQEEERLALETALMYGAKKTLNTEGVVKSRSDVDMNFDVENAVLGKDFRVTITF
QNNSSNLYTILAYLSGNITFYTGVSKKEFKTESFEVTLDPLSLEKKEVLIRAGEYMSYLL
EQGLLHFFVTARINETRVVLAKQKSIVLTIPKVTIKVRGTAMVGSDMVVTVEFTNPLKET
LKNVWLHLEGPGVMRPKRKMFREIRPNATVQWEEVCQPWVSGHRKLIASMTSDSLRHVYG
ELDLQIRRRPTV
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtcggatactccagcaactacctttgggggacggcgagcaatcccacccaacaactct
aatgcagcagaagtggacctcccgactgaggatctgcagggcctggtgcccaggggtgtc
agcctgaaagattacttgaatgtcacagctgttcacctgttcaaggagagatgggacagc
aacaagattgatcaccacacagacaaatatgacaacaataagttgattgtccgcagagga
cagactttctacatccagattgacttcaatcgcccatatgaccccaggaaggatctcttc
agagtggaatatgtcattggtcgctaccctcaggagaataagggcacctacatcccagtg
ccggtagtgacggagctgcaaagcggaaagtggggggccaaggttatcatgaatgaggac
aggtctgtgcggctttccgttcagtcttcccccgaatgcatcgtggggaaattccgcatg
tatgttgccgtctggactccctatggcatcctgcgtactcagagagacccggaaacagac
acatacattctcttcaatccttggtgcgaagaagacgctgtgtatctggatgatgagaaa
gaaagagaagagtacgtcctaaatgacatcggagtgatatttcatggggacttcaatgac
atcaagagcagaagctggagctatggccagtttgaagatggcatcctggacgcttgcttg
tatgtgatggacaaagctgagatggacctttctggcagagggaaccccatcaaagtcagc
cgagttggatcagcaatggtgaatgccaaggatgacgaaggtgttcttgttggatcatgg
gacaatgtctatgcctacggcatccctccatcagcctggacaggaagtgttgacattcta
ctagaatacagaagctcagaaacaccagtccgatatggccagtgctgggtttttgctggt
gtctttaacacatttttaaggtgccttggaatccctgcgagagtcattaccaattacttc
tcagcccacgacaatgatgccaatttgcaaatggacatcttcctggaagaagatgggagt
gtgagctccaaactcaccaaggattcagtgtggaactaccactgctggaatgaagcatgg
atgacgaggcctgatctccctgttggatttggaggatggcaagctgtggacagcacaccc
caagaaaacagcgatggcatgtaccgctgtggccctgcctctgttcaagccgttaagcac
ggccatgtctgcttccaatttgatgccccatttgtttttgcagaggtcaacagtgatctt
gtttacatcacagctaagaaagatggcacccacgtggtagagaacgtggatgccacccac
atcgggaagctaattgtgaccaaagaaattggaggagatgggatgcaggatatcacggat
acttacaaatttcaggaaggccaagaagaagagagactagcccttgaaactgccctgatg
tatggagccaagaagaccctcaatactgaaggcgtggtcaaatccagatctgatgtggac
atgaactttgatgtggaaaatgctgtgctgggaaaagacttcagagtgactatcaccttc
cagaacaatagctccaatctgtacaccatcctggcctatctttccggcaacatcaccttc
tacactggggtatccaagaaagagttcaagacagagtcctttgaagtgacgctggatccc
ttgtccttagagaaaaaggaggtgctgatcagagcaggcgagtatatgagctaccttctg
gaacagggcctcctgcacttcttcgtcactgcacgcatcaacgagaccagggtcgtcctg
gccaagcagaagtccatagtgctgactatccccaaggtcaccatcaaggtccgaggcact
gccatggttggctctgatatggttgtgactgttgagttcacaaatcctttgaaagaaacg
ctaaaaaatgtctggcttcacttggaaggtcctggagtgatgagacccaagaggaagatg
ttccgtgaaatccggcccaacgccactgtgcagtgggaagaagtctgtcagccttgggtc
tctggtcatcggaagctgattgccagcatgaccagtgactccctgagacatgtgtatgga
gagctggacctgcagattcgaagacgacctactgtataa

DBGET integrated database retrieval system