KEGG   Rattus norvegicus (rat): 289083Help
Entry
289083            CDS       T01003                                 

Gene name
Tsen15, RGD1308584
Definition
(RefSeq) tRNA splicing endonuclease subunit 15
  KO
K15324  tRNA-splicing endonuclease subunit Sen15
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    289083 (Tsen15)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA spricing factors
   tRNA splicing endonucleases
    289083 (Tsen15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sen15
Motif
Other DBs
NCBI-GeneID: 289083
NCBI-ProteinID: NP_001099428
RGD: 1308584
Ensembl: ENSRNOG00000002352
UniProt: D3ZFW1
Position
13q21
AA seq 128 aa AA seqDB search
MEERSDSEPTPGCSGPGPGPVRDGGAAHKWAPEDAWMGTHPKYLEMMELDIGDATQVYIA
FLVYLDLMESKSWHEVNCVGIPELQLICLLGTEIEGEGVQTVVPTPISASLSHNRIFLLE
DDGHPSWC
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcgcagcgattccgagcctaccccgggctgtagcgggcctggcccgggtccc
gttcgcgatggcggcgccgcccacaagtgggctccggaggacgcctggatgggcacacac
cctaagtacttagagatgatggaattagatataggagacgccacccaagtttatatagca
ttcttggtttacctggatctcatggagagtaaaagttggcatgaagtaaactgtgtagga
ataccagaactacagctcatctgcctcctgggcaccgagatcgaaggggaaggggtgcag
acggtggtgcctacgcccatttctgcttccctcagccataacagaatatttctcttagaa
gatgacggccacccttcttggtgctga

DBGET integrated database retrieval system