KEGG   Rattus norvegicus (rat): 289095Help
Entry
289095            CDS       T01003                                 

Gene name
Nmnat2
Definition
(RefSeq) nicotinamide nucleotide adenylyltransferase 2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00760  Nicotinate and nicotinamide metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    289095 (Nmnat2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     289095 (Nmnat2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     289095 (Nmnat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 289095
NCBI-ProteinID: NP_001041507
RGD: 1307331
Ensembl: ENSRNOG00000027697
Vega: OTTRNOG00000002094
UniProt: Q0HA29
Position
13q21
AA seq 307 aa AA seqDB search
MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGL
VSSRHRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
SMTPVIGQPQHENTQPIYQNSNVPTKPTAAKILGKVGESLGRICCVRPPVERFTFVDENA
NLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADADRI
MNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQ
LYINASG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccacaaagacccacgttatcctgctggcctgcggcagcttcaatcccatc
actaaagggcacattcagatgttcgaaagagccagggattatctgcacaagactggaaga
tttattgtgattggtggtattgtctctccagtccacgactcctatggaaaacagggtctt
gtgtcaagtcggcaccgtctcatcatgtgtcagctggctgtccaaaattctgactggatc
agggtggacccatgggagtgctaccaggacacctggcagacaacctgcagtgtgttagag
caccatcgagacctcatgaagagggtgaccggctgcatcctctccaacgtcaacacgcct
tccatgacacctgtgattggacagccacaacacgagaacacccagcccatttaccagaac
agcaatgtgcccaccaagcccactgcagccaagatcttgggaaaggtgggagagagcctc
ggccggatctgctgtgtccgtccacccgtggagcgcttcacttttgtagatgagaacgcc
aacctgggcacagtgatgcggtatgaggagatcgagctgcgcatcttgctgctgtgcggt
agtgacctgctggagtccttctgcatcccaggactctggaatgaggcagatatggaagtg
attgttggggattttgggattgtggtggtgccccgggatgcagcggacgcagaccgaatc
atgaatcactcctcaatactccgcaaatacaaaaacaacatcatggtagtgaaggatgac
atcaaccatcccatgtctgtagtcagctccaccaaaagcaggctggccctgcagcatggg
gatggccacgttgtggattacctgtcccagccggtcatcgactacatcctcaagagtcag
ctgtacatcaatgcctcgggctag

DBGET integrated database retrieval system