KEGG   Rattus norvegicus (rat): 289144
Entry
289144            CDS       T01003                                 

Gene name
Cacybp
Definition
(RefSeq) calcyclin binding protein
  KO
K04507  calcyclin binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    289144 (Cacybp)
SSDB
Motif
Pfam: Siah-Interact_N CS SGS DUF3090
Other DBs
NCBI-GeneID: 289144
NCBI-ProteinID: NP_001004208
RGD: 1303146
Ensembl: ENSRNOG00000002572
Vega: OTTRNOG00000000171
UniProt: Q6AYK6
Position
13q22
AA seq 229 aa
MASALEELQKDLEEVKVLLEKSTRKRLRDTLTNEKSKIETELRNKMQQKSQKKPEFDNEK
PAAVVAPLTTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPAENVQVHFTERSFDLLVKN
LNGKNYSMIVNNLLKPISVESSSKKVKTDTVIILCRKKAENTRWDYLTQVEKECKEKEKP
SYDTEADPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAREDTEF
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcttccgctttggaggagttgcagaaagacctagaagaggtcaaagtgctgctggaa
aagtccactaggaaaagactacgtgatactcttacaaatgaaaaatccaagattgagacg
gaactaaggaacaagatgcagcagaagtcacagaagaaaccagaatttgataatgaaaag
ccagctgctgtggttgctcctcttacaacagggtacactgtgaaaatcagtaattatgga
tgggatcagtcagataagtttgtgaaaatctacattactttaactggagttcatcaggtt
cctgctgagaatgtgcaagtacacttcacagagaggtcatttgatcttttggtaaaaaac
ctcaatggcaagaattactccatgattgtgaacaatcttttgaaacctatctctgtggaa
agcagttcaaaaaaagtcaagactgatacagttattatcctatgtagaaagaaagcagaa
aacacacgatgggactacttaactcaggtggaaaaagaatgcaaagagaaagaaaagcct
tcctacgacactgaggcagatcctagtgagggattaatgaatgttctaaagaaaatttat
gaagatggagatgatgacatgaagcgaaccattaataaagcgtgggtggaatcccgagag
aagcaagccagggaagacacagaattctga

DBGET integrated database retrieval system