KEGG   Rattus norvegicus (rat): 289175Help
Entry
289175            CDS       T01003                                 

Gene name
Slc19a2
Definition
(RefSeq) solute carrier family 19 member 2
  KO
K14610  solute carrier family 19 (thiamine transporter), member 2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04977  Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    289175 (Slc19a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    289175 (Slc19a2)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC19: Folate/thiamine transporter
   289175 (Slc19a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folate_carrier MFS_1 Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 289175
NCBI-ProteinID: NP_001025195
RGD: 1308611
Ensembl: ENSRNOG00000002839
Vega: OTTRNOG00000001157
UniProt: Q499Q0
Position
13q23
AA seq 498 aa AA seqDB search
MDVPARVSRRAAAAAARMLLRTARVPRECWFLPTALLCAYGFFANLRPSEPFLTPYLLGP
DKNLTERQVFNEIYPVWTYSYLLLLFPVFLATDYLRYKPVILLQGLSLIVTWFMLLYAQG
LLAVQFLEFFYGIATATEIAYYSYIYTVVDLGMYQKVTSYCRSATLVGFTVGSVLGQILV
SVVGWSLFSLNVLSLTCVSVAFAVAWFLPMPQKSLFFHHIPSSCHGVNGLKVQNGGITTD
TPASNHLPGWEDIESKIPLNLDEPPVEEPEEPKPDRLRVFKVLWNDFLMCYSSRPLLCWS
VWWALSTCGYFQVVNYAQGLWEKVMPSQNAVIYNGGVEAVSTLLGASAVFAVGYIKLSWS
TWGEVTLFLCSLLIAAAVYIMDTVENIWVCYASYVVFRIIYMVLITIATFQIAANLSMER
YALVFGVNTFIALALQTLLTLIVVDARGLGLCIITQFLIYASYFAAISVVFLANGIVSIV
KKCRKQEDPNSSPQATTS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgcccgcccgggtgtcccgacgagctgcggcggcggcggccaggatgctccta
cgtactgcccgcgtccctcgcgagtgctggttcctgccgaccgcgctgctctgcgcctac
ggtttcttcgcaaacctccggccgtcggagccgttcctcactccctacctgctggggccg
gacaagaacttgaccgagagacaggtcttcaatgaaatttatccagtgtggacatactct
tacctgctgctactcttccccgtgttccttgccacagactacctccgttacaagcctgtc
attctactgcagggactcagccttattgttacatggttcatgctgctctatgcccaagga
ctgctggctgttcagttcctggaattcttctatggcattgccacagccactgaaatcgcc
tactactcctatatctacactgtggtcgacctgggcatgtaccagaaagtcacaagttac
tgtagaagtgccaccttggtgggctttacagtgggctctgtcctagggcagatcctcgtc
tccgtggtgggctggtcactgttcagcttgaacgtcctctccctcacctgcgtttctgtg
gcctttgctgtggcctggtttctgcctatgccacagaagagcctcttctttcaccacatc
ccttcctcctgtcacggagtgaatggcctcaaggtacaaaatggcggcatcactactgat
accccagcatctaaccatcttcctggatgggaggacattgagtcaaaaatccctctaaat
ttagatgagcctccggtggaggaaccggaggagcccaagccagaccggctgcgggtgttc
aaagtcctgtggaatgacttcctgatgtgttactcctcccgccctctgctctgctggtcc
gtgtggtgggccctctccacctgcggttatttccaagtggtgaactacgcacagggattg
tgggagaaggtcatgccttctcagaatgctgtcatctacaatggcggtgtggaggctgtt
tcaaccttgctgggtgcaagtgctgtgtttgcggttggttatataaaactatcttggtca
acttggggagaggtgacgttattcctgtgttctcttctgattgctgctgcagtgtacatc
atggacaccgtggagaacatttgggtgtgctatgcatcctatgttgtcttcagaatcatc
tacatggtactcatcaccatagcaacttttcagattgctgcaaaccttagcatggagcgt
tacgcccttgtgtttggagtgaacaccttcattgctctggccttacagactctgctcact
ctgattgtggtagatgccaggggccttggcttgtgtattattactcagttcctgatttat
gcgagttactttgcagccatctctgtggttttcctggctaatggcatagtcagtattgta
aagaaatgcagaaagcaggaagatcccaactccagccctcaagcaaccacttcctaa

DBGET integrated database retrieval system