KEGG   Rattus norvegicus (rat): 289180Help
Entry
289180            CDS       T01003                                 

Gene name
Gpr161, RGD1563245
Definition
(RefSeq) G protein-coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    289180 (Gpr161)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    289180 (Gpr161)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    289180 (Gpr161)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 289180
NCBI-ProteinID: XP_001075481
RGD: 1563245
Ensembl: ENSRNOG00000003073
UniProt: F1M5Q2
Position
13q23
AA seq 528 aa AA seqDB search
MSLNSSLSYRKELSNLTAAEGGEGGAVSEFIAIIIITVLVCLGNLVIVVTLYKKSYLLTL
SNKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSALLYLLISSASMLTLGVI
AIDRYYAVLYPMVYPMKITGNRAVMALVYIWLHSLIGCLPPLFGWSSVEFDEFKWMCVAA
WHREPGYTVFWQIWCALFPFLIMLVCYGFIFRVARVKARKVHCGTVVTVEEDAQRSGRKN
SSTSTSSSGSRRNALQGVVYSANQCKALITILVVIGAFMVTWGPYMVVITSEALWGKNYV
SPTLETWATWLSFTSAICHPLIYGLWNKTVRKELLGMCFGDRYYRESFVQRQRTSRLFSI
SNRITDLGLSPHLTALMAGGQSLGHSSSTGDTGFSYSQDSGTDVMLLEDGASDDSPPQHC
TCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFGE
EALPGVLFTARTVPGASFGGRRGSRTLVNQRLQLQSIKEGNVLAAEQS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcaactcctccctcagctacaggaaggagctgagcaacctcactgccgcagag
ggtggcgaagggggcgctgtctccgagttcatcgccatcatcatcatcactgtcctcgtc
tgcctgggcaacctggtcatcgtggtcaccttgtacaagaaatcctaccttctcaccctc
agcaacaagttcgtcttcagtctgaccctgtccaacttcctgttgtccgtgctggtgctg
ccgttcgtggtgaccagctccatacggagggaatggatcttcggtgtggtctggtgcaac
ttctctgcccttctctacctgctgatcagctcggccagcatgctgacccttggcgttatt
gccatcgatcgctattacgctgtcctgtacccaatggtgtaccccatgaagatcacaggg
aaccgagctgtgatggctcttgtctacatctggcttcactctctcattggctgtctgcca
cccctctttggctggtcatcggtggagttcgatgagttcaagtggatgtgtgtggccgcg
tggcaccgggaacctggctacaccgttttctggcagatctggtgtgccctgttccccttc
ctcatcatgctagtctgctatggtttcatcttccgggtagccagggtcaaggcccgaaag
gtgcactgtggcacggtggtcactgtggaggaagacgcccagaggagtgggaggaagaat
tctagtacctccacttcctcctctggcagtaggaggaatgcccttcagggagtggtctat
tccgctaaccagtgcaaagccctcatcaccatcctggtggtcattggcgctttcatggtc
acctggggcccctacatggttgtcattacctcagaggcactctgggggaagaactatgtc
tcgccaaccctggagacttgggccacgtggctgtcctttaccagtgctatctgccatcct
ctgatctacggactctggaacaagactgttcgcaaggagctcctgggcatgtgctttggg
gaccgttactaccgggagtcatttgtgcagcgacagaggacctccaggctcttcagcatt
tccaacaggatcacagacctgggtctgtccccacacctcacggcactcatggcaggcgga
cagtccctgggacacagcagcagcactggtgacacaggcttcagctactctcaggattca
gggacagatgtgatgctactggaagacggtgcttctgatgacagccctccccagcactgc
acttgcccgcccaagaggaggagctccgtgacatttgaggacgaagtggaacagatcaaa
gaggctgccaagaactctattcttcatgtgaaagctgaagtacacaaatccttggacagt
tatgcagccagcttggctaaagccattgaggctgaagccaaaatcaacttatttggggag
gaggctctgccaggggtcttgttcacagcacggacagtcccgggggcgagctttgggggc
cgtcgaggcagcaggactcttgtgaatcagaggctgcagctacagagcatcaaggaaggg
aatgtcttagctgcagaacagagttga

DBGET integrated database retrieval system