KEGG   Rattus norvegicus (rat): 289201Help
Entry
289201            CDS       T01003                                 

Gene name
Lmx1a
Definition
(RefSeq) LIM homeobox transcription factor 1 alpha
  KO
K09371  LIM homeobox transcription factor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    289201 (Lmx1a)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    289201 (Lmx1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 289201
NCBI-ProteinID: NP_001099437
RGD: 1304784
Ensembl: ENSRNOG00000004642
UniProt: F1LRJ8
Position
13q24
AA seq 382 aa AA seqDB search
MLDGLKMEENFQSAIETSASFSSLLGRAVSPKSVCEGCQRVISDRFLLRLNDSFWHEQCV
QCASCKEPLETTCFYRDKKLYCKYHYEKLFAVKCGGCFEAIAPNEFVMRAQKSVYHLSCF
CCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAASDSGKSDDEESLCKSAHG
AGKGASEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQ
VWFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGSGNAGMEGIMNPYTTLPTPQQLL
AIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGP
LQSRVGNPIDHLYSMQNSYFTS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttggacggcctgaagatggaagagaactttcaaagtgcgattgagacctcggcctcc
ttctcctctttgctgggcagagcggtgagccccaagtctgtctgcgagggctgtcagcgg
gtcatctcggataggtttctgctgagactcaacgacagcttctggcacgagcaatgcgtg
cagtgcgcctcttgcaaagagcccctggagaccacctgcttctaccgggacaagaagctc
tactgcaagtaccactacgagaaactgtttgctgtcaaatgtgggggctgcttcgaagcc
attgcgcccaatgagtttgtcatgcgtgcccagaagagtgtgtaccacctgagctgtttc
tgctgctgtgtctgcgagcgacagctgcagaagggtgatgagtttgtcctgaaggagggc
cagctgctctgcaaaggagactatgagaaggagcgagagttgctgagcctggtgagccca
gcagcctcagactcaggcaaaagtgatgatgaggagagtctttgcaagtcagcccacggg
gcagggaaaggagcatcagaggacggcaaggaccataagcgacccaaacgtcccagaacc
atcttgaccactcagcagaggagagcattcaaggcctcatttgaagtatcctccaagccc
tgcagaaaggtgagggagactctggctgcggagacagggctgagtgtccgtgtggttcag
gtgtggttccagaaccagcgagccaagatgaagaagctggcccggcgacagcagcaacag
caacaggatcaacagaacacccagaggctgagttctgctcagacaaatggtagtggcaat
gctggcatggaaggcatcatgaacccctatacaacgttgcccaccccacagcaactgctg
gccattgaacagagcgtctacaactctgatcccttccgacagggtctcaccccaccccag
atgcctggagatcacatgcacccctacggtgctgaacctcttttccatgacctggatagt
gacgacacatctctcagtaacctgggcgactgcttcctggcaacctcagaagctggaccc
ctacagtccagagtgggaaaccccatcgaccatctgtattccatgcagaattcctatttc
acctcttga

DBGET integrated database retrieval system