KEGG   Rattus norvegicus (rat): 289211Help
Entry
289211            CDS       T01003                                 

Gene name
Fcgr2b, CD32, FCRII, FcgammaRIIB2, Fcgr2
Definition
(RefSeq) Fc fragment of IgG receptor IIb
  KO
K12560  low affinity immunoglobulin gamma Fc receptor II-b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04662  B cell receptor signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    289211 (Fcgr2b)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    289211 (Fcgr2b)
   04666 Fc gamma R-mediated phagocytosis
    289211 (Fcgr2b)
  09158 Development
   04380 Osteoclast differentiation
    289211 (Fcgr2b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    289211 (Fcgr2b)
   05152 Tuberculosis
    289211 (Fcgr2b)
  09172 Infectious disease: viral
   05162 Measles
    289211 (Fcgr2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    289211 (Fcgr2b)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    289211 (Fcgr2b)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    289211 (Fcgr2b)
CD molecules [BR:rno04090]
 Proteins
  289211 (Fcgr2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set Ig_5 DUF2613 Protocadherin C2-set
Motif
Other DBs
NCBI-GeneID: 289211
NCBI-ProteinID: NP_786932
RGD: 631331
Ensembl: ENSRNOG00000046452
UniProt: Q63203 Q5BKD6
Position
13q24
AA seq 285 aa AA seqDB search
MDSNRTVVHVLSRTLYHMLLWTAVLNLVAESHAGLPKAVVKLEPPWIQVLKEDTVTLMCE
GTHNTKNCSTQWFHNGSSIWHQAQANYTFKATVNDSGEYRCRMEETGISEPIHLGVISDW
LLLQTSQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYHQSSNFSIPKANHSHSG
NYYCKAYLGRTMHVSKPVTITVQEPKSSSSLPVLTIVAAVAGIAVAAIVIILVSLVYLKK
KQVPDTPSGLEEAEKNEVENTITYSLLKHPEAPDEESDHDYQNHI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaacaggactgtcgtccatgtgctctcacggactttgtaccatatgctactg
tggacagctgtgctaaatcttgttgctgagtctcatgcaggtcttccgaaggctgtggtg
aaacttgagcccccatggatccaggtgcttaaggaagacactgtgacactgatgtgcgaa
gggacccacaacaccaagaactgttctactcagtggtttcacaatgggagctccatctgg
catcaagcccaagccaactacacgtttaaggccacagtcaatgatagtggagaataccgg
tgccgaatggaggagaccggcatcagcgaacccatacatctgggagtgatttctgactgg
ctgctactccagacctctcaactggtgtttgaagaaggggaaaccatcacattaaggtgc
catagctggaagaacaaacagctgactaaggtcttgttgttccagaatggaaaacctgtg
aggtattatcatcaaagcagcaatttttcaatccccaaagccaaccacagtcacagtggg
aactactattgcaaagcatatctaggaaggacaatgcacgtgtccaagcctgtcaccatc
actgtccaagagcccaaatccagcagttcgttgccggtattgacgattgtagctgctgtc
gctggaattgctgtagctgccattgttattatcctggtatccttggtctatctcaagaaa
aagcaggttccagacactccttctggtctcgaagaagctgagaaaaatgaggtggagaat
acaatcacctattcacttctcaagcatcctgaagctccggatgaagaatcagatcacgac
taccagaaccacatttag

DBGET integrated database retrieval system