KEGG   Rattus norvegicus (rat): 289218
Entry
289218            CDS       T01003                                 

Gene name
Ndufs2
Definition
(RefSeq) NADH dehydrogenase (ubiquinone) Fe-S protein 2
  KO
K03935  NADH dehydrogenase (ubiquinone) Fe-S protein 2 [EC:7.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Module
rno_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    289218 (Ndufs2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    289218 (Ndufs2)
  09159 Environmental adaptation
   04714 Thermogenesis
    289218 (Ndufs2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    289218 (Ndufs2)
   05012 Parkinson disease
    289218 (Ndufs2)
   05014 Amyotrophic lateral sclerosis
    289218 (Ndufs2)
   05016 Huntington disease
    289218 (Ndufs2)
   05020 Prion disease
    289218 (Ndufs2)
   05022 Pathways of neurodegeneration - multiple diseases
    289218 (Ndufs2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    289218 (Ndufs2)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     289218 (Ndufs2)
SSDB
Motif
Pfam: Complex1_49kDa NiFeSe_Hases
Other DBs
NCBI-GeneID: 289218
NCBI-ProteinID: NP_001011907
RGD: 1307109
Ensembl: ENSRNOG00000038372
UniProt: Q641Y2
Position
13q24
AA seq 463 aa
MAALRAVCSLRGVGAQVLRAGSGIRLPSQPSRGARRWQPDIEWAEQFSGAVMYPSKETAH
WKPPPWNDVDVLKEKVVTNVTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGT
EKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRI
LNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGL
MDDIYEFSKNFSLRIDEVEEMLTNNRIWRNRTVDIGVVSAEDALNYGFSGVMLRGSGIQW
DLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSLRIIEQCLNKMPPGEIKVDD
AKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPY
RCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEIDR
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcggccctcagggctgtgtgcagcctccgcggtgtcggggcccaggtgctgcgggcc
gggtctgggattcgtctgccgagtcagcccagcagaggtgctcggcgatggcagccagat
atagaatgggcagagcagttttcgggagctgtcatgtatccctccaaggaaacagcccac
tggaaacctcctccttggaatgatgtggatgttttgaaggagaaagtggtgaccaacgtg
accctgaactttgggccccagcacccagcagctcatggagtcctgagactcgtgctggaa
ttgagtggagagatggtgcggaaatgtgaccctcacatcgggctcctacaccgaggcacg
gagaagctcatcgagtacaagacctatctgcaggcccttccatattttgaccggttggac
tatgtgtccatgatgtgtaatgaacaggcgtattcactagctgtggagaagttgctaaac
atccagcctcctccccgggcgcagtggatccgagtgctctttggagagatcacacggatt
ttaaaccatatcatggctgtcaccacacatgccctggacattggtgccatgacgcctttc
ttctggatgtttgaagaaagggagaagatgttcgagttctatgagcgggtgtctggagcc
cgtatgcatgctgcttatatccgaccaggaggagtgcaccaggacctacctcttgggctt
atggatgacatttatgaattttccaagaacttctctcttcggattgatgaggtggaggag
atgctgaccaacaatagaatctggcgaaataggacagtcgacattggggttgtatctgca
gaagatgcactgaactatggattcagtggagtgatgctccgaggctcaggcatccagtgg
gacttgcggaagacccagccatatgatgtttacgaccaggtggagtttgatgttcctatt
ggttctcgaggggactgctacgataggtatctgtgtcgtgtggaagagatgcgccagtcc
cttcgaatcatcgaacagtgtctgaacaagatgccgccgggggagatcaaggttgatgac
gccaaagtgtccccacctaaacgagcagagatgaagacgtccatggagtcactaattcat
cactttaagctgtatactgagggctaccaagttcctccaggagccacatacaccgccatt
gaagctcctaagggcgagtttggggtgtacttggtatctgatggcagcagccgaccttat
cggtgtaagatcaaggctcccggttttgcccacctggcaggtttggacaagatgtctaaa
ggacacatgctggcagatgtcgtagccatcataggcacccaggatattgtatttggagaa
atagaccgatga

DBGET integrated database retrieval system