KEGG   Rattus norvegicus (rat): 289222Help
Entry
289222            CDS       T01003                                 

Gene name
Nit1
Definition
(RefSeq) nitrilase 1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    289222 (Nit1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     289222 (Nit1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 289222
NCBI-ProteinID: NP_001076049
RGD: 727821
Ensembl: ENSRNOG00000003881
UniProt: Q7TQ94
Position
13q24
AA seq 291 aa AA seqDB search
MAESSSTSWELPLVAVCQVTSTPNKQENFKTCAELVQEATRLGACLAFLPEAFDFIARNP
AETLLLSEPLDGDLLGQYSQLARECGIWLSLGGFHERGQDWEQTQKIYNCHVLLNSKGSV
VASYRKTHLCDVEIPGQGPMRESNYTMPGYALEPPVKTPAGKVGLAICYDMRFPELSLKL
AQAGAEILTYPSAFGSVTGPAHWEVLLRARAIESQCYVIAAAQCGRHHETRASYGHSMVV
DPWGTVVASCSEGPGLCLARIDLHFLQQMRQHLPVFQHRRPDLYGSLLPLS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtcctcatcgacttcctgggagctgcccctggtggctgtgtgccaggtaaca
tcaacaccaaacaagcaagagaactttaaaacgtgtgctgagctggttcaagaggctacc
agactgggcgcttgcctggcctttctgcctgaggcatttgactttattgcacgaaatcct
gccgagacattactcctgtccgaaccactggatggggaccttttgggacaatatagccag
cttgccagggaatgtggaatctggctgtccttgggtggtttccacgagcgtggccaagac
tgggagcagactcagaaaatctacaattgtcatgtgcttctgaacagcaagggatcagta
gtggccagttacaggaagacacatctatgtgatgtagagatcccaggtcaggggcctatg
agagaaagcaactataccatgcctggatacgctcttgaaccacctgtcaagacaccagca
ggcaaggttggtctagcaatctgttatgacatgcggttccctgaactttctctgaaattg
gctcaagctggggcagaaatacttacttatccttcagcctttggatctgttaccggccca
gcccactgggaggtgctgctgcgggcccgcgccattgagtctcagtgctacgtgatagca
gcagcacagtgtggacgccaccatgagacaagagcaagttacggccacagcatggtggtt
gacccctggggcacagtggtggccagctgttccgagggaccaggcctttgccttgctcga
attgatctccactttctgcaacagatgcgccaacacttgcctgtgttccagcatcgcaga
cctgacctttatggcagtctcctgccactctcctaa

DBGET integrated database retrieval system