KEGG   Rattus norvegicus (rat): 289231
Entry
289231            CDS       T01003                                 

Gene name
Ncstn
Definition
(RefSeq) nicastrin
  KO
K06171  nicastrin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    289231 (Ncstn)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    289231 (Ncstn)
SSDB
Motif
Pfam: Nicastrin Ncstrn_small Peptidase_M28
Other DBs
NCBI-GeneID: 289231
NCBI-ProteinID: NP_777353
RGD: 631418
Ensembl: ENSRNOG00000005355
UniProt: Q8CGU6
Position
13q24
AA seq 708 aa
MATARGGSGPDPGSRGLLLLSFSVVLAGLCGGNSVERKIYIPLNKTAPCVRLLNATHQIG
CQSSISGDTGVIHVVEKEDDLKWVLTDGPNPPYMVLLEGKLFTRDIMEKLKGETSRIAGL
AVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKKTLWNELGNGLAYDDFSFPIF
LLEDENETKVIKQCYQDHNLGQNGSAPSFPLCAMQLFSHMHAVISTATCMRRSFIQSTFS
INPEIVCDPLSDYNVWSMLKPINTSGGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVAS
FVTQLAAAEALHKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMENGKFPVRLENIDS
FVELGQVALRTSLELWMHTDPMSQKNESVKNQVEDLLVTLEQSGADTPQVVLSRLVQSQA
LPPSSLQRFLRARNISGVVLADHSGSFHNRYYQSIYDTAENINVTYPESQSPEEDLNFVT
DTAKALADVATVLARALYKLAGGTNFNNSIQADPQTVTRLLYGFLVRANNSWFQSILRHD
LRSYLDDGPLQHYIAVSSPTNTTYVVQYALANLTGKVTNLTQEQCQDPSKVPNESKDLYE
YSWVQGPWNSNKTERLPRCVRSTVRLARALSPAFELSQWSSTEYSTWAESRWKDIQARIF
LIASKELEFITLIVGFSILVFSLIVTYCINAKADVLFVAPREPGAVSY
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggctacggctaggggcggctctgggcctgacccaggaagtcggggtctccttcttctg
tctttttccgtggtactagcaggattgtgtgggggaaactcagtggagaggaagatctac
attcccttaaataaaacagctccttgtgtccgcctgctcaatgccactcatcagattggc
tgccagtcttcaattagtggggatacaggggttatccacgtagtggagaaagaagacgac
ctgaaatgggtattgacggatggccccaaccccccttacatggttctgctggagggcaag
ctctttaccagagatataatggaaaagctgaagggggaaaccagtagaatcgctggtctt
gccgtgactctagccaagcccaattcaacgtcaagcttctctcctagcgtgcagtgccca
aatgatgggtttggtatttactccaactcctatgggccagagtttgctcactgcaaaaaa
acattgtggaatgaactgggcaatggcttggcttatgacgacttcagtttccccatcttt
cttcttgaagatgagaacgaaaccaaggtcatcaagcagtgctatcaagatcacaacctg
ggtcagaatggctctgcaccgagcttcccactgtgtgctatgcagctcttctcacacatg
cacgccgtcatcagcaccgccacctgcatgcgacgcagcttcatccagagcaccttcagc
atcaacccagaaatcgtctgtgaccccttatccgactacaacgtatggagcatgcttaag
cctataaatacgtctgggggattagaacctgatgtcagggttgtggttgcagccacacgg
ctggatagccggtccttcttctggaatgtggccccaggggcagaaagtgccgttgcctcc
tttgtcactcagctggccgcagctgaagctttgcacaaggcacctgatgtgaccacccta
ccccgaaatgtgatgtttgtcttcttccagggggaaacttttgactacattggcagctca
aggatggtctatgacatggagaacggcaagtttcctgtgcggctagagaacattgactcc
tttgtggagctggggcaggtggccctaaggacgtcactagaactctggatgcacacagat
cctatgtctcagaaaaatgaatctgtgaagaaccaggtggaggatcttctggtcactctg
gagcagagtggtgctgatacccctcaagttgtcctgagcagactagtccagtcccaggcc
cttccaccatcatctctacaacgatttcttcgggctcgaaacatctctggtgtggtcttg
gctgaccactctggttccttccacaatcggtattaccagagcatttatgacactgctgag
aacattaacgtgacctatcctgagtcgcagagcccagaagaggacctcaactttgtaaca
gacactgccaaggcactggcagatgttgccacagtgctggcacgagctttgtacaagctt
gcaggaggaaccaacttcaacaactccattcaggctgatccccagacagttacacgtctg
ctctatgggttcctggtcagagctaacaactcatggtttcagtctatcctcagacatgat
ctgaggtcctatttggatgatgggcctcttcaacactacatcgctgtctccagccctacc
aacacgacttacgttgtgcagtatgccttggcaaacctgactggcaaggtgaccaacctc
acccaagagcagtgccaggatccaagtaaagtcccaaatgaaagcaaggatttgtatgaa
tactcgtgggtacaaggcccttggaattccaacaagacagagcggctcccacggtgtgtg
cgctccacagtacgactggctagggccttgtcccccgcctttgagctgagtcagtggagc
tccacagaatactctacgtgggccgagagccgctggaaagatatccaagctcggatattc
ctcattgccagcaaagaacttgagttcatcacgctgatcgtgggcttcagcatcctcgtc
ttttctctcatcgtcacttattgtatcaacgccaaggccgatgtccttttcgttgctccc
cgagagccaggagctgtgtcttactga

DBGET integrated database retrieval system