KEGG   Rattus norvegicus (rat): 289233Help
Entry
289233            CDS       T01003                                 

Gene name
Pex19, PxF
Definition
(RefSeq) peroxisomal biogenesis factor 19
  KO
K13337  peroxin-19
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    289233 (Pex19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pex19 Rod-binding HHH_4 GAS
Motif
Other DBs
NCBI-GeneID: 289233
NCBI-ProteinID: NP_001100845
RGD: 1306913
Ensembl: ENSRNOG00000057116
UniProt: G3V907
Position
13q24
AA seq 299 aa AA seqDB search
MAAAEGGCGAGVEADRELEELLESALDDFDKAKPSPAPSPTISAPDASGPQKRSPGDTAK
DALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDAS
SQQEFTSCLKETLSGLAKNATDLQNAGMSEEELTKAMEGLGMDEGDGEGNILPIMQSLMQ
NLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQQQHSVMGKICEQFEAETPTDS
EATHRARFEAVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGANGEQCLIM
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgctgaaggaggttgcggtgctggggtcgaagcggaccgggaattggaggag
cttttggaaagtgctcttgatgattttgataaagccaaaccctccccagcaccctctcct
accatctcggcccccgatgcttcagggccccagaagagatcgccaggagacactgccaaa
gatgctctctttgcctcccaagagaaatttttccaggaactgttcgacagtgagctggct
tcccaagccaccgcagagtttgagaaggcaatgaaggagctggctgaggaagagccccat
ctggtggagcagttccagaagctctcagaggcagctgggagagtgggcagcgatgcaagt
tctcaacaagaatttacttcttgcctaaaggagacattaagtgggctagccaaaaatgcc
actgaccttcagaacgcaggcatgtctgaagaagaactgacaaaagccatggaagggctg
ggcatggatgaaggagacggggaagggaacattctccccatcatgcagagcctcatgcag
aacctcttgtctaaggatgtattgtatccatccctgaaggagatcaccgaaaagtatcca
gaatggctacagagtcaccaggagtctattcccccagagcagtttgagaagtatcagcag
cagcacagtgtcatgggcaaaatctgcgagcagttcgaggcagagacgcccacagacagc
gaggctactcacagggctcgctttgaggcggtactcgatcttatgcagcagttacaggac
ttgggccaccctccgaaagagctggctggggagatgcctcctggcctcaactttgacctg
gatgccctcaatctatcgggcccaccaggtgctaatggcgaacagtgtctgatcatgtga

DBGET integrated database retrieval system