KEGG   Rattus norvegicus (rat): 289236Help
Entry
289236            CDS       T01003                                 

Gene name
Vsig8, RGD1562464
Definition
(RefSeq) V-set and immunoglobulin domain containing 8
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set Ig_2 ig
Motif
Other DBs
NCBI-GeneID: 289236
NCBI-ProteinID: NP_001099442
RGD: 1562464
Ensembl: ENSRNOG00000008668
UniProt: D4A7V8
Position
13q24
AA seq 417 aa AA seqDB search
MGVRGAFHLLLVCLSPALLSAVRINGDGQEVLFLAEGDNVRLGCPYILDPEDYGPNGLDI
EWMQVNSEPSHRENVFLTYQDKRISHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDT
ATYECRVKKTTMATRKVVVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWA
KISGHSHPYRAGSYHSQHSFHSELSYQESFHSSINQGLSNGDLVLKGVNADDDGLYQCTV
ANHVGYSVCVVEVKVSDSQRVGMIVGAVLGSLLMLACLAVGIWGLICCCCGGAGAGGARG
AFGYGVGGGVGGGACGDLASEIRVDAEAPGCKASGRGSRVTHLLGYPTQNVSRSLRRKYA
PPPCGGPEDVALVPRTTSAACEAGPSPVYIKVKSAEPADCADCAQVEQRSCKDGLLV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcgaggagcgttccatctactgctcgtgtgcctgagcccagcattgttgtct
gctgtaaggatcaatggggatggccaggaggtcctgttcctggcagaaggtgacaatgtg
aggctaggctgtccctacatcctggatcctgaagattatggtcccaatggtctggatatt
gagtggatgcaagttaactcagaaccctcgcatagggagaatgtgtttcttacttatcaa
gacaagcggatcagtcacggcaacctccctcatctgcagcagagggtccgcttcgcagcc
tcagaccccagccagtacgatgcctccatcaacctcatgaacctgcaggtgtctgacaca
gcaacctatgagtgtcgggtgaagaagaccaccatggccaccaggaaggtcgtggtcact
gtccaagcacgtcctgccgtacccatgtgttggactgaaggccacatgtcaaagggcaac
gatgtggtgctgaagtgctttgccaacggaggctctcagcccctctcctacaagtgggcc
aagatcagtgggcacagccacccctaccgagctgggtcctaccactcacagcacagcttc
cactctgagctttcttaccaagagtcgttccacagctccatcaaccaaggcctgagcaac
ggagacctggtgttgaagggcgtcaacgcggacgacgatgggctgtatcagtgcacagtg
gccaaccatgtgggctacagcgtctgcgtggtagaggtgaaagtctcagactcccagcgt
gtaggcatgatcgtcggcgcagtgctgggctctttgctcatgctagcctgcctggcagta
ggcatctgggggctcatctgctgctgctgcggaggcgccggggccggtggtgcccgaggt
gccttcggctacggggtcggcggcggggtcggcggaggggcctgcggcgacttggctagt
gagatcagagtggacgccgaggcgcccgggtgcaaggccagcgggcgcggcagccgcgtc
acccacctcctggggtacccgacgcagaacgtcagccgctccctgcgccgcaagtacgcg
cctccgccctgcggcggccccgaggacgtggccctagtgccccgcaccacctctgccgcc
tgcgaagcgggtccctccccggtctacatcaaggtcaagagcgcggagccggccgactgc
gccgactgtgcccaggtcgagcagcgctcgtgcaaggacggcctcttagtgtga

DBGET integrated database retrieval system