KEGG   Rattus norvegicus (rat): 289264
Entry
289264            CDS       T01003                                 

Gene name
Grem2
Definition
(RefSeq) gremlin-2 precursor
  KO
K23318  gremlin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    289264 (Grem2)
SSDB
Motif
Pfam: DAN Cys_knot TIR_2 Arc_MA
Other DBs
NCBI-GeneID: 289264
NCBI-ProteinID: NP_001099444
RGD: 1560008
Ensembl: ENSRNOG00000003616
UniProt: D3ZXD0
Position
13
AA seq 168 aa
MFWKLSLTLLLVAVLVKVAETRKNRPAGAIPSPYKDGSTNNSERWHHQIKEVLASSQEAL
VVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEDSFQSC
AFCKPQRVTSVIVELECPGLDPPFRIKKIQKVKHCRCMSVNLSDSDKQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttctggaagctctcgctgaccttgctcctggtggctgtgctggtaaaggtagccgaa
acacggaagaacaggcctgcgggcgccatcccctcgccttacaaggatggtagcaccaac
aactcagagagatggcatcaccagatcaaggaggtgctggcctccagccaggaggccctg
gtggtcaccgagcgcaagtacctgaagagtgactggtgcaagacgcagccactgcggcag
acggtgagcgaggagggttgccgcagccgcaccatcctcaaccgcttttgctatggccag
tgcaactccttctacatcccacgacacgtgaaaaaggaggaggactccttccaatcctgc
gctttctgcaagccccagcgtgtcacctctgtcatcgtggagctcgaatgcccgggtctc
gatccacctttccgaatcaagaagatccagaaggtgaagcattgccggtgcatgtcggtg
aacctcagtgactctgacaagcagtga

KEGG   Rattus norvegicus (rat): 50566
Entry
50566             CDS       T01003                                 

Gene name
Grem1
Definition
(RefSeq) gremlin-1 precursor
  KO
K23318  gremlin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    50566 (Grem1)
SSDB
Motif
Pfam: DAN
Other DBs
NCBI-GeneID: 50566
NCBI-ProteinID: NP_062155
RGD: 2359
Ensembl: ENSRNOG00000026053
UniProt: O35793
Position
3
AA seq 184 aa
MNRTAYTVGALLLLLGTLLPAAEGKKKGSQGAIPPPDKAQHNDSEQTQSPPQPGSRTRGR
GQGRGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYG
QCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCIS
IDLD
NT seq 555 nt   +upstreamnt  +downstreamnt
atgaatcgcacggcatacaccgtaggagctttgcttctcctcctgggaaccctactgcca
gcagctgaagggaaaaagaaagggtcccaaggagccatcccacctcctgacaaggctcag
cacaatgactccgagcagacccagtccccaccacaacctggctccaggacccgggggcgg
ggccaggggcggggcaccgccatgcctggagaggaggtgcttgagtccagccaagaggcc
ctgcatgtgacagagcgcaaatacctgaagcgagattggtgcaaaactcagcccctgaag
cagaccatccatgaggagggctgcaacagccgcactatcatcaatcgcttctgttacggc
cagtgcaactccttctacatccccaggcatatccgaaaagaggaaggctcctttcagtct
tgctccttctgcaagcccaagaaattcaccaccatgatggtcacactcaactgtcctgag
ctacagccacccaccaagaagaaaagagtcacacgcgtgaagcagtgtcgttgcatatcc
atcgacttggattaa

DBGET integrated database retrieval system