KEGG   Rattus norvegicus (rat): 289295Help
Entry
289295            CDS       T01003                                 

Gene name
Vom2r30, RGD1561133
Definition
(RefSeq) vomeronasal 2 receptor, 30
  KO
K04613  vomeronasal 2 receptor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    289295 (Vom2r30)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    289295 (Vom2r30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3 ANF_receptor NCD3G Ephrin_rec_like
Motif
Other DBs
NCBI-GeneID: 289295
NCBI-ProteinID: NP_001092937
RGD: 1561133
Position
1q21
AA seq 849 aa AA seqDB search
MFILMVVFFFLNLPHLMANFTDPRCFWRINLDEDQNKDLGISCSFILGAVQLPMEKDYFN
QTLNVLKTTKTNKYALVLAFSMNEINRNPDLLPNMSLVIKHTLSYCDGKTVHHIVKEKFY
NPLPNYICNEETMCSFLLTGLNWISSIKLFRELDVFLFPRFLQISYGPFHSIFSDNEQFP
YVYQMTPKDTLLPLAMVSIIHYFNWNWVGLVISDNDEGNQFLSELKKETQTKEICFAFVT
MMTINDLSSYHKTEMYYNEIVMSSTNVIIIYGETDSIIELSFRMWKSPVIQRIWITKSEL
DFPTSNGDLSHDIFYGTLTFLHHHGEISGFKNFVETRYHLKSRDLNLLIPEWNYFNYEAS
ASNCKILRNYSSNSSLEWLTEQKFQMAFNDESNSIYNAVYAMAHALHEKNLQEVDNQEIK
NGKRTSTHCLKLNSFLRKTHFTNPLGDKVIMKQRERVQEDYDIVHIQNFSQRLRIKVKIG
KFSPYFPHGGRFHLYEEMIELATGSRKMPSSVCSADCSPGFRKIWKEGMAACCFICSPCP
ENEISNETNMDQCVNCPEYQYANKEKNKCIQKGVIFLSYEDPLGMVLALIAFCLSVFTAV
VFCVFVKNHDTPIVKANNRILSYLLVMSLMFCFLCSFFFIGHPNNATCILQQITFGITFT
VAVSTVLAKTITVVLAFKITDPGRMLRNFLVLGAPNYIIPICSLLQCILCAIWLAVSPPF
VDIDKHSEHGHIIIVCNKGSVMAFYCVLGYLACLALGSFTMAFLAKNLPDTFNEAKYLTF
SILVFFSVWVTFLPVYHSTKGRVMVAVEIFSILSSSAGMLGCIFTPKIYIILVKPERNSI
QRIREKSYF
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgttcattttgatggtagtattcttcttcctcaaccttccacatctcatggcaaatttc
actgatcccaggtgcttttggagaataaatttggatgaagatcagaataaagacttgggt
ataagttgttccttcatccttggagcagttcagttacctatggagaaagattatttcaac
cagactctgaatgtcctaaaaacaactaaaaccaacaaatatgccttggtattagccttt
tcaatgaatgaaatcaacaggaatcctgatcttttaccaaatatgtctttggttataaaa
catactttgagctattgtgatggaaaaactgtacaccacatagttaaagaaaaattttat
aaccctttacctaattacatctgtaatgaagagactatgtgttcatttctgcttacagga
ctgaattggatatcatcaataaagctttttagagagttggacgtcttcttatttccacgt
ttccttcagatttcctatggacctttccattccatcttcagtgataatgaacaatttcca
tatgtctatcagatgaccccaaaggacacattactacccttggcaatggtctccatcata
cattacttcaactggaactgggttggccttgtcatctcagataatgatgaaggcaatcaa
tttctctcagagttgaaaaaagagacccaaaccaaggaaatttgctttgcctttgtaacc
atgatgacaatcaatgacctttcatcctatcataaaacagagatgtactacaatgaaatt
gtgatgtcatcaacaaatgttattatcatttatggggaaacagatagtattattgaattg
agcttcagaatgtggaaatctccagttatacagaggatttggatcaccaaatcagagttg
gatttccccacaagtaacggagacttaagtcatgacatattctatgggactctcacattt
ttacaccaccatggtgagatttctggatttaaaaattttgtagagacacggtaccatctc
aaaagcagagatttaaatctgttaataccagaatggaattactttaactatgaagcctca
gcatctaactgtaaaatactgaggaactattcatccaattcctcattggaatggctaaca
gaacagaagtttcagatggcctttaatgatgagagtaatagcatatacaatgctgtgtat
gccatggcccatgctctccatgagaaaaatctgcaagaggttgataatcaggaaataaaa
aatgggaaaagaacaagtactcactgcttgaagttaaactcctttctcagaaagactcac
tttactaatcctcttggggacaaagtgattatgaaacagagagagagagtgcaggaagac
tatgacattgttcacattcagaatttctcacaacgccttcggattaaagtgaagatagga
aagttcagcccatattttccacatggtggacgctttcacttatatgaagaaatgattgag
ttggccacaggaagtagaaagatgccatcctctgtgtgcagtgcagattgtagtcctgga
ttcagaaaaatctggaaggaaggaatggcagcctgctgttttatttgcagcccctgccct
gaaaatgaaatttctaatgagacaaatatggatcagtgtgtgaattgtccagaataccag
tatgccaacaaagaaaagaacaaatgcattcagaaaggtgtgatttttctaagctatgaa
gacccattggggatggttcttgccttaatagccttctgtttgtctgtcttcacagctgtg
gtattttgtgtctttgtgaagaaccatgacactcctattgtgaaagccaataacagaatc
ctcagctacctattagtcatgtcactcatgttctgttttctgtgctcctttttcttcatt
ggccatcctaacaatgctacctgtatcttacagcaaatcacatttggaattaccttcact
gtggctgtttccacagttctggccaaaacaataactgtggttctggctttcaaaatcaca
gacccaggaagaatgttaagaaacttcctggtattgggggcacctaactacattattccc
atatgttccttattgcaatgtattctgtgtgcaatttggctagcagtttctcctcccttt
gttgatattgacaaacattctgagcatggccacatcataatcgtgtgcaacaagggctct
gttatggcgttctactgtgtcctaggatacttggcctgcttggcccttggaagcttcact
atggctttcttggcaaaaaatctgcctgacacattcaatgaagccaaatacttaaccttc
agcattctagtgttcttcagtgtctgggtaacctttcttcctgtgtaccatagcaccaag
ggcagagtcatggttgctgtggagatcttctccatcttgtcatccagtgcagggatgctt
ggatgcatatttacacccaaaatctacatcattttagtgaaaccagagagaaattctatc
caaaggatcagggagaaatcatatttctga

DBGET integrated database retrieval system