KEGG   Rattus norvegicus (rat): 289322
Entry
289322            CDS       T01003                                 

Gene name
RGD1564463
Definition
(RefSeq) sphingolipid delta(4)-desaturase DES1
  KO
K04712  sphingolipid 4-desaturase/C4-monooxygenase [EC:1.14.19.17 1.14.18.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    289322 (RGD1564463)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    289322 (RGD1564463)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    289322 (RGD1564463)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     289322 (RGD1564463)
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.17  sphingolipid 4-desaturase
     289322 (RGD1564463)
Lipid biosynthesis proteins [BR:rno01004]
 Desaturase
  Sphingolipid
   289322 (RGD1564463)
SSDB
Motif
Pfam: FA_desaturase Lipid_DES
Other DBs
NCBI-GeneID: 289322
NCBI-ProteinID: XP_223005
RGD: 1564463
Ensembl: ENSRNOG00000003601
UniProt: D3ZXB2
Position
13
AA seq 324 aa
MGSRVSREDFEWVYTDEPHAQRRREILAKYPEIKSLMKPDPNLIWIITAMILVQLASFYL
VKDLEWKWLIFWSYVFGSSINHSMTLAIHEISHNFPFGHHRALWNRWFGIFTNLPFGIPY
SISYKMYHIDHHRYLGTAGIDVDAPSDLEGWFFCTTFRKLVWVAFQPFFLLFRPYFVNPK
PMTYLETINIMSQITFNIVIYHVWGIKSLVYMLAASLLGLGLNPISGHFIADHFMFSKGQ
DTNSYYGPLNFFMFNGGYHNEHHDFPSIPGSRLPQVRKIAAEYYDELPHHTSWVKVLYDF
VTDDTMSPYSRIKRPPKGNEVLHK
NT seq 975 nt   +upstreamnt  +downstreamnt
atgggcagccgcgtttctcgggaagattttgagtgggtctacacggatgagccgcatgcg
cagagaagacgggagatcctggcaaagtatccagagataaaatccttgatgaagcccgac
cctaacctgatctggatcataaccgcaatgattctcgtccagttggcttccttctactta
gtcaaagacttagagtggaaatggctcatattttggtcctatgtctttggcagctctatt
aaccattcaatgactctggctatccatgagatttcccacaacttccccttcggccaccac
agggccctgtggaaccgctggtttgggatatttactaatctcccttttgggattccatat
tcgatttcctataaaatgtatcacatagatcaccaccgataccttgggactgctggcatt
gacgtggatgctccttctgaccttgagggctggttcttctgcaccactttcaggaagctt
gtctgggttgctttccaacctttctttctcttatttcgaccttattttgtcaaccccaaa
ccaatgacttacctggaaactattaatattatgagccagatcacttttaacattgtcatt
taccacgtctggggaattaagtccttagtctacatgttggcagcctctctccttggcttg
ggtttgaatcccatttctgggcattttatagctgaccacttcatgttctcaaagggacaa
gacacaaactcctattatgggcctcttaactttttcatgttcaatggcggctaccacaac
gaacaccacgacttccccagtattcctggaagccgtcttcctcaggtgaggaaaatcgca
gctgagtactatgatgagctcccgcatcacacctcctgggtgaaggtgctgtatgatttt
gtgacggatgacacaatgagcccctactccaggataaagaggccaccgaaagggaacgag
gttctacataaataa

KEGG   Rattus norvegicus (rat): 314438
Entry
314438            CDS       T01003                                 

Gene name
Degs2
Definition
(RefSeq) sphingolipid delta(4)-desaturase/C4-monooxygenase DES2
  KO
K04712  sphingolipid 4-desaturase/C4-monooxygenase [EC:1.14.19.17 1.14.18.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    314438 (Degs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    314438 (Degs2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    314438 (Degs2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     314438 (Degs2)
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.17  sphingolipid 4-desaturase
     314438 (Degs2)
Lipid biosynthesis proteins [BR:rno01004]
 Desaturase
  Sphingolipid
   314438 (Degs2)
SSDB
Motif
Pfam: FA_desaturase Lipid_DES
Other DBs
NCBI-GeneID: 314438
NCBI-ProteinID: NP_001017457
RGD: 1305023
Ensembl: ENSRNOG00000011716
UniProt: Q564G3
Position
6
AA seq 323 aa
MGNSAARSDFEWVYSDQPHTQRRKEMLAKYPSIKALMRPDPNIKWTVLGMVLVQVLACWL
VRGLSWRWLLFWAYAFGGCINHSLTLAIHDISHNTAFGTRCASRNRWFAVFANLPIGLPY
ATSFKKYHVDHHRYLGGDGLDVDIPTDFEGWFFCTPARKLLWLVLQPFFYSLRPLYVNPK
AVTRMEILNALVQLAFNVTIFALWGIKAIVYLLASSLLGLGLHPISGHFVAEHYMFLKGH
ETYSYYGPLNWITFNVGYHVEHHDFPSIPGCYLPLVRMIAPEYYDHLPQHHSWVKVLWDF
VFEDSLGPYSRVKRKCKLAKDQL
NT seq 972 nt   +upstreamnt  +downstreamnt
atgggtaacagcgcagcccgcagcgacttcgagtgggtctacagcgaccagccgcacacc
cagaggcgcaaagagatgctcgccaagtacccatccatcaaggccctgatgcggccagac
cccaacatcaagtggaccgtgctgggaatggtactggtgcaggtgctggcctgctggctg
gtacgggggctctcttggcgatggttgctgttttgggcctatgcctttggcggctgcatc
aaccactcactgacactggccatccatgacatctcgcacaacactgcctttggcacacgc
tgtgcctcccgcaaccgctggtttgccgtctttgctaatctgcccattggcctaccttac
gccacgtccttcaaaaagtaccacgtggaccaccatcgttacctgggcggagacgggctg
gatgtggatatccccacagacttcgagggctggttcttctgcacaccggcccgcaagctg
ctttggctggtgcttcaacccttcttctactcactcaggccactctatgtgaaccccaag
gcggtgacgcgtatggagatcctcaatgccctggtgcagttggcatttaatgtcaccatc
tttgccctctgggggatcaaagccatagtctaccttctagccagctctctcctgggcctg
ggcctgcaccctatctctggccacttcgtggcagagcattatatgttcctgaagggccac
gagacgtactcctactatgggcctctcaactggattaccttcaatgttggctaccacgtg
gaacaccacgacttccccagcatccccggttgctacctgccactggtacggatgattgca
cccgaatactacgaccatctgccgcagcaccactcctgggtgaaagtgctctgggacttc
gtgtttgaggactctctgggaccctactccagggttaagcgcaagtgcaagctggcgaag
gaccagctgtga

KEGG   Rattus norvegicus (rat): 498300
Entry
498300            CDS       T01003                                 

Definition
(RefSeq) sphingolipid delta(4)-desaturase DES1
  KO
K04712  sphingolipid 4-desaturase/C4-monooxygenase [EC:1.14.19.17 1.14.18.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    498300
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    498300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    498300
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     498300
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.17  sphingolipid 4-desaturase
     498300
Lipid biosynthesis proteins [BR:rno01004]
 Desaturase
  Sphingolipid
   498300
SSDB
Motif
Pfam: FA_desaturase
Other DBs
NCBI-GeneID: 498300
NCBI-ProteinID: XP_038947403
RGD: 1593185
Position
13
AA seq 282 aa
MKPDRNLIWIVTAIVLTQLASLYLVKDLDWKRLIFCAYVFGGSINHSLILGSPEICHNFP
FGHHRALWNRWFRIFANLPIGVLYSISFKRYHMDHHRYLGADGIDVGVPRDLEGWFFCTT
FRRLVWVAFQPLFITFRPLFINPKPISDLETINAVAQIAFDLIVYSVFGIKSLVYMLASS
MLGLGLHPISGNLIGDHCLFLKEHKTFYYGPLNLLTFNVGYPTEHHDFPNIPGKDLPLVR
KIAAEYYDKLPHHISWVKVLYDFVMDNTINPYSPKKMLPEGK
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaagcccgaccgtaacctgatctggatcgtaaccgcaatagttcttacccagttggct
tcactttacttagtcaaagacttggactggaagcggctcatattttgtgcctatgtattt
ggtggctctattaaccactcactaattttaggttctcctgagatctgtcataatttcccc
ttcggccaccacagggccctgtggaaccgctggtttagaatatttgcgaacctccctatc
ggggttctgtattcgatttcctttaagaggtaccacatggatcatcaccggtaccttggg
gcggacggcatcgatgtgggtgttcctcgtgatcttgagggctggttcttctgcaccact
ttcaggaggctggtctgggttgctttccaaccactctttattacttttcggcctctattt
atcaaccccaaaccaatttctgacctggaaaccatcaatgctgttgctcagatcgctttt
gacctgatagtttactctgttttcggaattaaatctttagtctacatgctggcatcctcc
atgcttggtctgggtttgcacccaatttctggcaatcttataggggaccattgcctcttc
ttaaaggaacacaagacattctactatgggcctctgaacttactcaccttcaatgtgggc
tatcccaccgaacaccatgacttccccaacattcctggaaaagacctgcccttggtgagg
aaaatagcggctgaatactatgataaactcccccatcacatctcctgggtcaaagtgctg
tatgattttgtgatggacaacacaataaatccctattcaccgaagaagatgcttccagaa
gggaaatag

KEGG   Rattus norvegicus (rat): 58970
Entry
58970             CDS       T01003                                 

Gene name
Degs1
Definition
(RefSeq) sphingolipid delta(4)-desaturase DES1
  KO
K04712  sphingolipid 4-desaturase/C4-monooxygenase [EC:1.14.19.17 1.14.18.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    58970 (Degs1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    58970 (Degs1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    58970 (Degs1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     58970 (Degs1)
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.17  sphingolipid 4-desaturase
     58970 (Degs1)
Lipid biosynthesis proteins [BR:rno01004]
 Desaturase
  Sphingolipid
   58970 (Degs1)
SSDB
Motif
Pfam: FA_desaturase Lipid_DES
Other DBs
NCBI-GeneID: 58970
NCBI-ProteinID: NP_445775
RGD: 70917
Ensembl: ENSRNOG00000003223
UniProt: Q5XIF5
Position
13
AA seq 323 aa
MGNRVSREEFEWVYTDQPHAARRQEILAKYPEIKSLMKPDPNLIWIVTSMLLVQLASFYL
VKDLDWKWLMFWSYAFGSCLNHSMTLAIHEISHNFPFGHHKAMWNRWFGMFANLSLGVPY
SISFKRYHMDHHRYLGADGIDVDIPTDFEGWFFCTTLRKLVWVILQPLFYAFRPLFINPK
PITHLEVINTVIQVTFDVLVYYVFGVKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGH
ETYSYYGPLNLLTFNVGYHNEHHDFPNVPGKNLPLVRKIASEYYDNLPHYNSWIRVLYDF
VMDDTISPYSRMKRPPKGNEIQE
NT seq 972 nt   +upstreamnt  +downstreamnt
atggggaaccgcgtgtcccgagaggagttcgaatgggtctacacggaccagccccacgcc
gcccggcgccaggagatcttagcgaagtatccagagataaaatccttgatgaagcccgac
cctaacctgatctggattgtaacctcaatgcttctcgtccagttggcttcgttttactta
gtcaaagacttggactggaagtggctcatgttttggtcctatgcctttggcagctgcctt
aaccattccatgactctggctatccatgagatttcccacaacttcccctttggccaccac
aaggccatgtggaaccgctggtttggaatgttcgcgaacctctctctcggggttccatat
tcgatttcctttaagaggtaccacatggatcatcaccggtacctcggggcggacggcatc
gatgtggatatccctactgatttcgagggctggttcttctgcaccactctcaggaagctt
gtctgggttatccttcagcctctcttctatgcgtttagacccctgttcatcaaccccaag
ccaattacccatctggaagtcatcaacactgtgatccaggtcacttttgacgtcctcgtc
tactatgtttttggagtgaagtctctagtgtacatgttggcagcctccctgctcggcctg
ggcttgcacccaatttcggggcatttcatagccgaacattacatgttcctaaagggacac
gaaacatactcctactatgggcctctgaacttactcaccttcaatgtgggctatcacaac
gaacaccacgacttccccaatgttcctgggaaaaacctgcccctggtgagaaaaatcgca
agtgagtactatgataacctcccacactacaactcctggatccgagtgctgtatgacttt
gtgatggacgacacaataagtccctactcacggatgaagaggcccccgaaagggaatgag
attcaggagtaa

DBGET integrated database retrieval system