KEGG   Rattus norvegicus (rat): 289395
Entry
289395            CDS       T01003                                 

Gene name
Cr2
Definition
(RefSeq) complement receptor type 2 precursor
  KO
K04012  complement receptor type 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04640  Hematopoietic cell lineage
rno04662  B cell receptor signaling pathway
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    289395 (Cr2)
   04610 Complement and coagulation cascades
    289395 (Cr2)
   04662 B cell receptor signaling pathway
    289395 (Cr2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    289395 (Cr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    289395 (Cr2)
CD molecules [BR:rno04090]
 Proteins
  289395 (Cr2)
SSDB
Motif
Pfam: Sushi DUF6019
Other DBs
NCBI-GeneID: 289395
NCBI-ProteinID: NP_001099459
RGD: 1310065
Ensembl: ENSRNOG00000034164
UniProt: D3Z9F7
Position
13
AA seq 1029 aa
MGALGSLWVFFALIAPGVLELSCDPPPEVNNTRRLYYSLPVLPGTVVRYTCLPGYRLIGE
KAIFCISKDQVTATWDKATPICEPWNKMSACSKPIVPGGIINPGSRPPFKHGDSVTVTCK
ANFTMKGSKTVWCRANKMWGPTPLPVCESDFPLECPSLPTIHNGHHTGQHVEKFVAGLSV
TYSCEPGYLLVGKKTIKCLSSGAWDDVIPTCKEAKCERPEKLPNGQVKEPPSLRVGTTVY
FSCNEGYELQGQPSSKCVIVEQKAVWTKKPVCKEILCPPPPPVLNGRHSGRFSGNVPYGN
NVTYMCDPSPEKGVNFTLIGEKTIYCTNSSEKTGIWSGPAPYCKLSISEAQCLRPQINRG
QILSILKESYSYNDTVAFSCEPGFTLKGSGRIRCSAQGTWKPPVPVCEKGCQAPPKIING
QKEDRYFLNFDPGTSIRYSCDPGYFLVGEDTIHCTSEGKWTPIPPQCKVAECKPVGPHVF
ERPQNHFIRPAINSSCDEGFQISESAYQLCQGTIPWFIEIRLCKEITCPPPPIILNGTHT
WRSSEDVPYGTVITYMCYPGSEEGVKFKLIGEQTIHCTSDSRGRGSWSSPAPLCKLSLPA
VQCTEVHVENGVKLTDNKAPYFYNNSVTFKCRDGYILIGSSQIRCKANNTWDPEAPHCKK
EGCEPMRKLPGISDHSLIKLVNRTCQNGYQLTGYTYEKCQNAENGTWFQKIAVCTVILCP
PPPTIANGSHTGMMAEHFLYGNEVSYECDKGFYLLGEKSLQCKGHGSWSGPPPQCLQSSP
LTHCPDPEVKYGYKLNKTHSAYSHNDIIHVVCNQGFIMNGSHLIRCHTNNTWLPGVPTCI
RTASLGCQSPPTIPNGNHTGGTIARFSPGMSVMYSCYQGYLMAGEARLICTHEGTWSHPA
PYCKEVNCSFPEDTNGIQKGFQPGKTYRFGTTVTLECEDGYSLEGSPQSQCQDENQWNPP
LAICKNRSTVPLVSGISAGSAFIILISVIFFIILKSRERNYYTKTRPKDGALHLETREVY
AVDPYNPAS
NT seq 3090 nt   +upstreamnt  +downstreamnt
atgggagccttgggttcgctctgggttttcttcgctctcatcgctccgggagttcttgag
ctttcttgtgaccctcctcctgaagtaaacaatactcggagactctattactctcttccc
gtacttcctgggacggtcgtgaggtacacttgtttacctgggtatcgcctcattggagaa
aaggctatcttttgtataagtaaagatcaagtgactgccacctgggataaagctacacct
atatgtgaaccttggaataaaatgtctgcttgctcaaagcccatagtaccagggggaatc
ataaatccaggatctagaccaccattcaaacatggtgattctgtgacagttacctgtaaa
gccaacttcaccatgaaagggagcaaaactgtctggtgccgggcaaataaaatgtgggga
ccaacacccctgccagtctgtgagagtgatttccctctggagtgcccatcacttccaacg
attcataatggacaccacacaggacagcatgttgaaaagtttgttgcggggttgtctgtg
acatatagttgtgaacctggctatttgcttgttggaaaaaagacaatcaagtgcttatct
tcaggagcctgggatgatgtcatcccaacatgcaaagaggccaagtgtgaacgtccagaa
aagcttcccaatgggcaggtaaaagagcctccgagtcttcgggttggcacaactgtgtac
ttctcctgtaatgaagggtacgagttacaaggacaaccatctagtaagtgtgtaattgtt
gaacagaaagccgtctggaccaaaaagccagtatgtaaagaaattctctgcccaccacct
ccacctgttcttaatggaagacattcaggcagattttcaggaaatgtaccatatggaaac
aacgttacctacatgtgtgacccaagcccagagaaaggagtgaacttcactcttatcgga
gagaagactatctattgtaccaacagtagtgagaagactgggatctggagtggccctgct
ccgtactgtaaactttcaatttctgaagctcagtgtctacgaccccagattaataggggg
caaatattatctattttgaaggagagttattcatataatgacactgtggcattttcttgt
gaacctggcttcaccttgaagggcagcgggagaattcgatgcagtgcccagggcacatgg
aagccaccagtaccagtgtgtgaaaagggatgtcaggctcctcctaaaatcatcaatggg
caaaaagaagatcgatacttcctcaactttgaccctggtacatccataagatatagctgt
gaccctggctatttcctggtgggagaggacacgatacattgtacctctgaggggaagtgg
acacccattcccccccagtgcaaagttgcagagtgtaagccggtaggaccacatgtcttt
gagaggcctcagaatcactttattagaccagccatcaattcttcttgtgatgaagggttc
cagataagtgagagtgcttatcaactgtgtcaaggtacaattccttggtttatagagatt
cgtctttgtaaagaaatcacctgcccaccacctcctattatcctcaatgggacacataca
tggcgttcctcagaagatgtcccatacggaactgtcatcacttacatgtgctatcctggg
tcagaggaaggagtaaaattcaaactcatcggggaacaaaccatccactgtacaagtgat
agcagaggaagaggctcctggagtagccctgctcctctctgtaaactttccctccctgct
gtccagtgcacagaagtccatgttgaaaatggagtcaagctcactgacaataaagcccca
tacttctacaataatagtgtgacattcaaatgtcgtgatggatacattttgattggaagc
agtcagatccggtgtaaagccaataacacctgggaccctgaagcaccacattgtaaaaaa
gaaggatgtgaacctatgagaaaacttcctggcatttcagatcattcacttataaaacta
gtaaatagaacctgtcaaaatgggtaccagttgactggatatacttatgagaagtgtcaa
aatgctgagaatgggacttggttccaaaagattgcagtttgtacagtcattctctgtcca
cctccaccaacaattgcaaatggtagtcacactggcatgatggcagagcacttcctgtat
ggaaatgaagtttcttatgaatgtgataaagggttctatcttttgggagagaaaagtttg
cagtgcaaaggtcatggatcttggagtggacctccaccacagtgcttacaatcttctcct
ttaactcattgccctgatccagaagtcaaatatggatacaaactcaataaaactcattct
gcatattctcataatgatataatacatgttgtctgcaatcaaggcttcatcatgaatggc
agtcacttgataaggtgtcatactaataacacatggttaccaggtgtaccaacttgtatc
agaactgcttctttagggtgtcagtctccacccacaatccccaatgggaatcatactggt
gggactatagctcgattttcccctggaatgtcagtcatgtacagttgttaccaaggctac
cttatggctggagaggcacgtcttatttgtactcatgagggtacctggagccatcctgcc
ccttattgcaaagaggtaaactgtagcttccctgaagatacaaatggaatccagaaggga
tttcagcctgggaaaacctatcggtttgggactactgtgactctggaatgtgaggatggg
tattccttggagggaagtccacagagccagtgccaggatgaaaaccaatggaaccctccg
ctggctatctgcaaaaaccggtcaactgttcctcttgtttctggtatttctgcaggctca
gcatttatcattttgattagtgtcatcttctttataatattaaaatccagagagcgcaat
tattatacaaaaacaaggcccaaagatggagctcttcatttagaaacgcgagaagtatat
gctgttgatccatacaacccagcaagttga

DBGET integrated database retrieval system