KEGG   Rattus norvegicus (rat): 289400
Entry
289400            CDS       T01003                                 

Gene name
Camsap2, Camsap1l1, RGD1310950
Definition
(RefSeq) calmodulin regulated spectrin-associated protein family, member 2
  KO
K17493  calmodulin-regulated spectrin-associated protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    289400 (Camsap2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    289400 (Camsap2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     289400 (Camsap2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     289400 (Camsap2)
  Intermediate filaments
   Intermediate filament-binding proteins
    289400 (Camsap2)
SSDB
Motif
Pfam: CAMSAP_CKK CAMSAP_CH CAMSAP_CC1
Other DBs
NCBI-GeneID: 289400
NCBI-ProteinID: NP_001127975
RGD: 1310950
Ensembl: ENSRNOG00000008741
UniProt: D4AEC2
Position
13q13
AA seq 1470 aa
MGDAADPREVRRTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTETVPEELREPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAHKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWINKVNEHLKDIMEQEQKSKEHHTAEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLP
CIPLVENLLKDGTDGCALAALIHFYCPAVVRLEDICLKETMSLADSLYNLQLIQEFCQEY
LNHCCHFSLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVRPQGAEPAKDMPS
VPVLNAAKRNVLDSSSSSDFTSRYTRPQTHSSVSGGIRRSSSMSYVDGFIGTWPKEKRTS
VHGVSFDISFDKEDNAQSSTPNRGIIRSVSNEGLNNSRASKHIRKNLSFKPVNGGEEESI
EEELHVDPHGDLKSYMPLSTNELNSNENTHHKLPNGALQNRVLLDEFGNQIETPSIEEAL
QIIHDTEKPPHTARPDQIANGFFLHGQDLSLLNSNIKLSQSSPDNITDPKGALSPITDTT
EVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQDYDIRASNPREALSPCPS
TISTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSSSQKTTPEGSELNIPHMVS
WAQIPEESGVAQGRDTTQLLASEMVHLRMRLEEKRRAIEAQKKKMEAAFTKQRQKMGRTA
FLTVVKKKGDGISPLREEAAGAEDEKVYTDRAKEKESQKMDGQRSKSLADIKESMENPQG
KWLKSPSTPVDPEKQWNLTSPSEETLNEGELLEYTKSIEKLNSSLHFLQQEMQRLSLQQE
MLMQMREQQSWVISPPQPSPQKQIRDFKPRQAGLSSAAAPFSADSPRPTHPSPQSSTRKS
ASFSVKNQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFSPSQVPIQTRSFVCFGDDGE
PQKEPKPKEEIKKEPSECKGTLESCDHNPGEKEVKPLESTVSEVLSQPITETVCVTPNED
QLNQPTDPPPKPVFPPTAPKNVNLIEVSLSDLKPPEKADVSVEKFDGESDKEQFDDDQKV
CCGFFFKDDQKAENDMAVKRAALLEKRLRREKETQLRKQQLEAEMEHRKEETRRKTEEER
QKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQVAKQKKQRPKSIHRDHIESPKT
PIKGPPVSSLSLASLNTGDTESVHSGKRTPRSESVEGFLSPSRCGSRNGEKDWENASTTS
SVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFL
ILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSHIPAKTL
SASVDAITIHSHLWQTKRPVTPKKLLPTKA
NT seq 4413 nt   +upstreamnt  +downstreamnt
atgggggatgctgcagacccgcgggaggtgagaaggacgttcattgttccagccatcaaa
ccctttgaccactatgacttctccagagccaaaatcgcctgcaatctggcctggctggtg
gccaaagcctttgggacagaaactgtgccagaggaacttcgagaaccattttacacagat
cagtatgaccaggaacacatcaagccccctgtcgttaacctgcttctgtcagcggagctg
tactgtcgtgctggcagtctcatcctcaagagtgacgctgcaaagcccctcctgggccac
gatgctgtaatccaggcattagcacacaaaggcctgtatgtcactgaccaggaaaaactg
gtaactgaaagagacctccacaagaaacccatacagatgagtgcacacttggccatgatc
gatactctaatgatggcttacactgtagagatggtcagcatagagaaagtaattgcatgt
gctcaacagtattcagctttttttcaagccacagatctgccctatgatatcgaggatgct
gtcatgtactggataaataaggtaaatgaacacttgaaagacataatggaacaagaacaa
aaatctaaagagcaccacacggctgaagctccaggaggtcaaaagtctccttccaaatgg
ttttggaaactggttccagctcgttacaggaaggagcaaacactgcttaagcaactgcct
tgcattccattggtggaaaacttgttgaaggacggcacggatggctgtgcgctggctgcc
ctcattcacttctactgccctgctgttgtccgactagaagatatttgtttgaaagaaact
atgtctttggccgacagtctgtataacctgcagctgattcaggaattttgccaagaatac
ttaaaccattgctgccatttcagcttggaagatatgctttatgctgcttcgtccataaag
agtaattatttggtgttcatggcagaactcttctggtggttcgaagttgtgaagccttcc
tttgtgcagcctcgtgttgtccgtccacaaggagctgagcctgcgaaagacatgccatcg
gttcctgtcttaaatgctgccaaaagaaacgtcctggatagttcttctagttctgacttc
acctccagatatacacgtccccaaactcattcttcagtctcaggaggaattagaaggtct
tcatctatgtcttatgttgatggcttcataggaacatggcctaaagagaaaagaacatct
gtacatggcgtttcatttgatatttctttcgataaagaagacaatgcccagagctccact
ccaaaccgaggaatcatccgctctgttagtaatgaggggctcaacaacagtcgggcatcc
aaacacattaggaaaaatctgtccttcaagccagtgaatggaggagaagaggaaagcatt
gaagaagaacttcatgtcgaccctcatggggacctcaaatcttacatgcctctcagcaca
aatgaactgaactctaatgagaatactcaccacaagctcccaaacggggctttacaaaat
agagtgcttctagatgagtttgggaatcagattgaaactccgagcattgaagaagcatta
cagataatccatgatactgaaaaacctcctcatacagcgcggccagatcagattgctaat
ggcttctttcttcacggtcaggatctgagtctcctgaattcaaatatcaagctaagccag
tccagtcctgataacataactgacccaaaaggcgccttgagtcccataactgacactaca
gaagtcgacactggaattcacgttccttcagaagacattcccgaaaccatggacgaggac
tcttccttgagagattatactgttagcttagactctgacatggatgatgcgtctaaattt
cttcaggactatgatataagagccagcaaccccagagaggccctgagtccctgcccaagt
accatcagcaccaagtctcagccggggagcagcgcctcctccagctctggggtgaaaatg
accagcttcgctgagcagaagttcaggaagctgaatcatactgatgggaagagtagtggg
agcagttctcagaaaactaccccggaaggctcagagctgaatattcctcacatggtttct
tgggctcaaattccagaagaatcgggtgttgcccaaggccgggacactacacagctgttg
gcgtctgaaatggtgcatcttaggatgaggctagaggaaaagagacgtgctatagaagcc
cagaaaaagaaaatggaagctgcttttaccaaacagaggcagaaaatgggaaggacagcg
ttcctaactgttgtgaaaaagaaaggggatgggatttctcctctccgagaggaagcagca
ggtgcagaagacgagaaagtatatactgaccgagccaaagagaaggagtcacagaaaatg
gacgggcagaggagcaagtccttagcagacataaaagaaagcatggagaaccctcagggc
aaatggctaaagtccccaagcacgcctgttgatcccgagaagcagtggaacctgacaagt
ccctcagaggagactttaaatgagggagaacttttagagtacacaaagtccatcgaaaag
ctgaattcatccctgcactttctacaacaggaaatgcagcgcttgtcccttcagcaggag
atgttaatgcagatgagagagcagcagtcttgggtgatctcacctccgcagccctctcca
cagaagcagatccgcgattttaaacctagacaggcaggcctgtcgtcagctgctgcaccg
ttctcagcagactccccacgccccactcatccgtctccgcagtcttctaccaggaagagt
gcatctttttctgttaaaaatcaaaggactccaaggccaaatgaattaaaaataactcct
ctgaatcgaaccttgacacctcctcggtctgtggatagtcttcctcggctaaggaggttt
tccccgagccaggttcccattcagacacggtcgttcgtatgttttggtgatgatggagag
ccccaaaaagagcccaaaccaaaagaggagattaaaaaggagccttcagagtgcaaaggg
actttggaatcttgtgaccataatcctggggagaaggaggttaaacctcttgaatcaaca
gtgtctgaagtgttgtcacagcccatcacagagactgtgtgtgtgacaccaaatgaggac
caactgaatcaacccacagatcctccgcctaagcccgttttcccacctactgctcctaaa
aatgtcaatctgattgaagtttctctgtcagatttaaaaccccctgaaaaggctgatgtg
tctgttgaaaagtttgatggagagagtgacaaggaacagtttgatgatgaccagaaagta
tgctgtggcttcttttttaaggatgatcaaaaggcagaaaatgacatggccgtgaaacga
gcagctctgttggagaagcgattgaggagagagaaggaaactcagcttcggaagcagcag
ctggaagcggagatggagcataggaaagaggagacgaggcgaaaaactgaggaagaacgt
cagaagaaagaggacgagcgggcacggagagaattcattaggcaggagtacatgaggcga
aagcagctgaagctaatggaggacatggacacagtaatcaagcctcggcctcaggtggca
aaacagaaaaaacagcggccaaaatctattcacagagatcatattgaatctcccaaaaca
ccaatcaaaggccctccagtctctagcctctctctggcatcgctgaacacaggtgatacc
gagagtgttcattcaggcaagaggacaccaaggtcagagtctgtagaaggcttcttatct
ccaagtcgctgtggcagtcggaatggcgagaaagactgggaaaacgcatccacgacctct
tcagtggcttctggaacagaatacacaggaccaaagctttacaaggaacctagcgcaaaa
tccaataaacacataatacagaatgcattagctcattgctgtttggctggaaaagtaaat
gaaggtcagaagaaaaaaatattagaggaaatggagaagtcagatgccaacaacttctta
atcttgttccgggattcaggctgccagttcaggtctttgtatacttactgcccagaaact
gaagaaatcaataaactgactgggataggccctaagtctatcactaaaaagatgattgag
gggctttacaagtacaattctgacagaaaacagtttagccacatacctgctaaaacctta
tctgctagtgtggatgccattaccattcatagccacttgtggcagaccaaaagaccagtg
acacccaaaaaactcttacctactaaagcatag

DBGET integrated database retrieval system