KEGG   Rattus norvegicus (rat): 289419
Entry
289419            CDS       T01003                                 

Gene name
Nuak2, 1200013b22rik, Snark, UV126
Definition
(RefSeq) NUAK family kinase 2
  KO
K08800  NUAK family, SNF1-like kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    289419 (Nuak2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     289419 (Nuak2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   289419 (Nuak2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo RIO1 FTA2 APH
Other DBs
NCBI-GeneID: 289419
NCBI-ProteinID: NP_001007618
RGD: 1359167
Ensembl: ENSRNOG00000000034
UniProt: Q66HE5
Position
13q13
AA seq 630 aa
MESVALHRRGNLAPSASALATESARPLADRLIKSPKPLMKKQAVKRHHHKHNLRHRYEFL
ETLGKGTYGKVKKARESSGRLVAIKSIRKDKIKDEQDLLHIRREIEIMSSLNHPHIIAIH
EVFENSSKIVIVMEYASRGDLYDYISERPRLNERDARHFFRQIVSALHYCHQNGIVHRDL
KLENILLDASGNIKIADFGLSNLYHKGKFLQTFCGSPLYASPEIVNGKPYVGPEVDSWSL
GVLLYILVHGTMPFDGQDHKTLVKQISSGAYREPCKPSDACGLIRWLLMVNPIRRATLED
VASHWWVNWGYSTRIGEQEALREGGHPSGDSGRASMADWLRRSSRPLLENGAKVCSFFKQ
HVPGGGSTGPGLERQHSLKKSRKENDMAQTLQNDPAEDTSSRPGKNSLKLPKGILKKKAS
PSSGEVQEGPQELRPVSNTPGQPVPAIPLLPRKGILKKSRQRESGYYSSPEPSESGELLD
AGDVFVSGDPMEQKSPQASGRLHRKGILKLNGKFSRTALEGTAPSTFGSLDQLASPHPTA
RASRPSGAVSEDSILSSESFDQLDLPERLPETPLRGCVSVDNLRRLEQPPSEGLKRWWQE
SLGDSCFSLTDCQEVTAAYRQALGICSKLS
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggagtcggtggccttacaccggcgcgggaacctggctccctcggcctccgccctggcc
acggagagcgcccggccgctggcggaccggctcatcaagtcgcccaaacctctgatgaag
aagcaggcggtgaagcggcaccatcacaaacacaacctgaggcaccgctacgagttcctg
gagaccctgggcaagggcacctacgggaaggtgaagaaagcacgagagagctcgggacgc
ctggtggccatcaagtctatcaggaaggacaaaatcaaagatgagcaggatctgttgcac
ataaggagggagatcgagatcatgtcttcactcaaccacccccacatcattgccatccat
gaagtgtttgagaacagcagcaagattgtgattgtcatggagtacgccagccgaggcgat
ctgtacgattacatcagtgagcggccacggctgaatgagcgggacgccaggcatttcttc
cgacagatcgtgtccgccctgcactactgccaccagaacgggattgttcaccgggacctc
aagctggagaacatccttctagatgccagtggcaacatcaagattgctgattttggcctc
tccaacctgtatcacaaaggcaagttcctccagacgttctgtgggagccctctctatgcc
tcacctgagatcgtcaacgggaagccctatgtgggcccagaggtggacagctggtctctg
ggcgttcttctgtacatcctggtgcatggcaccatgccctttgacgggcaggatcataaa
accctggtgaaacaaatcagtagcggggcttaccgagagccgtgcaaaccgtctgatgcc
tgtggcctgatccggtggctgttaatggtgaatcccatccgtcgggccactctggaggat
gtagccagtcattggtgggtcaactggggttacagcacccgaattggggaacaggaagct
ctgcgagagggtgggcaccctagcggtgactctggccgggcctctatggcggactggtta
cgtcgctcctcccgccccctcctggagaatggagccaaagtgtgtagcttcttcaagcag
catgtgccgggaggtggaagcacgggaccggggctggagcggcaacattctcttaagaag
tcccgcaaggagaatgacatggctcagactctgcagaatgacccagctgaagatacttcc
tctcgccctggcaagaacagcctcaagcttccgaaaggtatcctcaagaaaaaggcctct
ccctcatcgggggaggtacaggagggccctcaggaactcagaccagtgtccaatacccca
gggcagcctgtccctgctatacccctgctcccaaggaagggcattcttaagaagtctcgg
cagcgtgaatctggttactactcctctccagagcccagtgagtctggggaactcttagac
gcaggtgatgtgtttgtgagtggggaccccatggagcagaagtctccacaagcttcaggg
cgcctccatcgcaagggcatcctcaaactcaatggcaagttttcccgcacagccttagaa
ggcactgcccctagcacctttggctccctagaccaactggcctcccctcatcctacagcc
cgggccagccgtccctcgggagctgtgagtgaggacagcatcctgtcctccgagtccttt
gaccaattggacttgcccgagcggcttcccgaaaccccactgaggggctgtgtgtctgtg
gacaacctgaggaggcttgagcagcctccctcagaaggcctaaaacgatggtggcaggaa
tccttgggggatagctgcttttctctgacagactgccaagaggtgacagcagcctacaga
caagccctaggaatctgctcgaagctcagctga

DBGET integrated database retrieval system