KEGG   Rattus norvegicus (rat): 289437Help
Entry
289437            CDS       T01003                                 

Gene name
Glmn
Definition
(RefSeq) glomulin, FKBP associated protein
  KO
K23345  glomulin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    289437 (Glmn)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    289437 (Glmn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinetochor_Ybp2
Motif
Other DBs
NCBI-GeneID: 289437
NCBI-ProteinID: NP_001099463
RGD: 1588600
Ensembl: ENSRNOG00000002054
UniProt: D3ZKQ3
Position
14p22
AA seq 596 aa AA seqDB search
MAVEELQCIIKRCQILEEHDFKEEDFGLFQLAGQRCIEDGYINQLLEIIQDEKNKTIIKT
MGWNLVGPVVRCLLRGREEDKREECFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQI
ILLLLQPLQTVIQKLPNNKAYSAGLALSTLWSQLSLLPVPHSEEQIQADDYGLCQCCRAL
IEFTKPFVAEVASDKEDPANTKLKDELLKFCFKSLKCPLLTAQFLEQSEEVGNDPFRCFA
SEIIGFLSQIGYPVPQIILNHGRKKRTWDYLEFEEEEDRQLADSVAALTYLVFVQGIGTD
QLPMVLSPSYLLQLNMEHIEVLLQRTEQSVYSKGLELLETSLLRLEDNSLCYQYLEIKSF
LAVPQGLVKVMTLCPIETLRKTGLAMLQLYIDKLDSQGKYTLFRCLLNTSNHSGVEAFVI
QNIKNQIDLSYKKTHNRWFAGAQLTSLLDLVLSLPEGAETDLLQNSDRIMASLNLLRYLV
IKDNEDDNQTGLWTELGKIENNFLQPLHVGLNMSKAHYEAEIKNSQQNSQAASMCKSVCS
VTVGGEEIPTMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKSKSTSEENAGMK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggaggaacttcagtgcataataaaaagatgtcaaatcctagaagagcatgat
tttaaagaagaagattttggcctctttcagctagcaggccaaagatgcattgaagatggg
tatataaaccagctgctagagattattcaagatgaaaagaacaagaccatcattaagact
atggggtggaatcttgttggtcctgttgtccgatgcctcctgaggggcagggaagaggat
aaaagagaagagtgttttctgatctttgatttgctggtgaagttgtgtaatccaaaggaa
ttgttgttgggtttgcttgaactcattgaagagccctccgggaaacagatatctcaaatt
attcttcttttactgcaaccattacagacagttattcagaaacttcctaacaacaaggca
tactcggctggattagcattgtccacgctctggagtcagctgtctcttcttcctgtccca
cactcagaagaacaaatacaggcagatgactatggcctttgtcagtgttgcagggccttg
atagagttcacgaaaccctttgtggcagaagttgctagtgataaagaagacccagcaaac
acaaagctgaaggatgaactactgaaattctgtttcaaaagcttgaaatgccctttgctg
acagcacaattcctcgaacagtctgaagaagttggaaatgaccctttccggtgttttgca
tctgaaataataggatttttatcacaaattggatatcctgtcccccaaattattcttaat
catggaaggaaaaaaaggacttgggattaccttgaatttgaagaagaagaagacagacaa
ctggcagactctgtggctgctctgacatacctagtctttgttcagggcatcggtaccgac
cagcttcccatggtcttaagcccttcataccttttgcagttgaacatggagcacattgaa
gtgcttctgcaaagaacagaacagtctgtttactccaaaggcttggaactgctggagact
agcttattgagattagaagacaacagcctatgttatcagtacctagaaatcaagagtttc
cttgctgtgcctcagggcttagtcaaagtcatgacactctgtcccattgagacactgagg
aaaacagggttagccatgcttcagctgtacatcgacaagttggactcccaaggcaaatac
acattatttaggtgcttactaaatacgagtaatcactcaggtgtggaagcctttgtaatt
caaaatatcaaaaatcagattgatttatcatataagaaaacccataacaggtggtttgca
ggcgcacagctgacctctctgttagacctggtcctgtccctccctgagggcgctgagaca
gatttactgcagaactcagaccggattatggcttcactaaatttgttgaggtatttggtt
atcaaagataatgaagatgacaaccaaactggattatggacagagcttggaaagattgaa
aataactttctacagccacttcatgtaggacttaatatgtcaaaggcacattatgaagca
gagattaaaaacagccaacaaaatagccaagctgcctcaatgtgtaaaagtgtttgttct
gtgactgtaggcggagaagaaatccccactatgcctcctgagatgcagcttaaggtctta
cattccgccctcttcacattcgacttgattgaaagtgtcctggctcgagtcgaagaactc
attgaaatcaaatcaaagtctacctctgaggaaaacgctgggatgaagtaa

DBGET integrated database retrieval system