KEGG   Rattus norvegicus (rat): 289508Help
Entry
289508            CDS       T01003                                 

Gene name
Rchy1, Pirh2
Definition
(RefSeq) ring finger and CHY zinc finger domain containing 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04115  p53 signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    289508 (Rchy1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    289508 (Rchy1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    289508 (Rchy1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    289508 (Rchy1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     289508 (Rchy1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    289508 (Rchy1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-C3HC4_3 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 289508
NCBI-ProteinID: NP_001007619
RGD: 1359180
Ensembl: ENSRNOG00000002546
UniProt: Q5XIE4
Position
14p22
AA seq 261 aa AA seqDB search
MAATAQEDGVRSPAPGPRGCEHYDRACLLKAPCCDKLYTCRLCHDTHEDHQLDRFKVKEV
QCINCEKLQHAQQTCEDCSTLFGEYYCSICHLFDKDKKQYHCESCGICRIGPKEDFFHCL
KCNLCLAMTLRGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG
YRCPLCMHSALDMTRYWRQLDIEVAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKC
KLCDSYNTAQAGGRTVSMDEQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacggcgcaggaagatggcgtccgcagcccggctccagggccgcggggttgc
gagcactatgacagagcctgtctcctcaaggcaccttgttgtgacaagctctatacatgc
cggctatgtcacgacacccacgaagatcatcagctggaccgcttcaaagtaaaggaagtg
cagtgcatcaactgtgaaaaactccagcatgcccagcagacttgtgaggactgcagcaca
ctgtttggagaatattactgcagtatttgccacctgtttgacaaagacaagaagcagtat
cactgtgagagctgtgggatttgtaggattggtccaaaggaagatttttttcattgcttg
aaatgtaacttatgcctagccatgactcttcgaggaaaacacaagtgtattgaaaatgtt
tcccggcagaattgtccaatatgcttggaggacattcatacctcccgtgtcgttgctcat
gtcttgccatgcgggcatctcctacatagaacgtgttatgaagaaatgttgaaagaaggt
tacagatgcccattgtgtatgcattctgccctagacatgactcggtactggagacaatta
gacattgaggtagcacagactcctatgccatccgaataccagaacgtgaccgttgatatt
ctctgcaatgactgtaatggacgatccacagtccagttccatatcttaggcatgaaatgt
aagctttgtgactcctacaatactgctcaggctggaggccgcacagtgtccatggatgag
cagtga

DBGET integrated database retrieval system