KEGG   Rattus norvegicus (rat): 289560Help
Entry
289560            CDS       T01003                                 

Gene name
Igfbp7
Definition
(RefSeq) insulin-like growth factor binding protein 7
  KO
K23580  insulin-like growth factor-binding protein 7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    289560 (Igfbp7)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    289560 (Igfbp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Kazal_2 IGFBP Kazal_1 ig Ig_2 V-set
Motif
Other DBs
NCBI-GeneID: 289560
NCBI-ProteinID: NP_001013066
RGD: 1306201
Ensembl: ENSRNOG00000002050
UniProt: Q5RJM3
Position
14p11
AA seq 281 aa AA seqDB search
MERSPRALLLGAAGLLLLLLPLSSSSSSDACGPCVPASCPALPPFGCPLGETRDACGCCP
VCARGEGEPCGGGAAGGGHCAPGMECVKSRKRRRGKAGAAAGGPATLAVCVCKSRYPVCG
SDGVTYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNITGAKVYLSC
EVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKE
DTGEYECHASNSQGQASASAKITVVDAIHEIPVKKGEGAQL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggagcggtcaccgcgcgccctgctgctgggtgcagccggattgctgctcctgctcctg
cccctctcctcttcctcctcttccgatgcctgcggcccgtgcgtgccggcctcctgcccc
gcgctgcccccgttcggctgcccgctgggtgagacccgcgacgcgtgcggctgctgccca
gtgtgcgctcgcggcgagggtgagccgtgcgggggcggcgcggccggcggggggcactgc
gcgccgggcatggagtgcgtgaagagccgcaagaggcggaggggtaaagccggggcagca
gccggcggtcccgcgaccctcgccgtgtgcgtgtgcaagagccgctacccggtgtgcggc
agcgacggcgtcacctaccccagcggctgccagctgcgcgccgccagcctgcgcgctgag
agccgcggagagaaggccatcacccaggtcagcaaaggcacctgcgagcaaggtccttcc
atagtgacgccccccaaggacatctggaacatcactggcgccaaggtgtacttgagctgc
gaagtcatcggaatcccaacccctgtcctcatctggaacaaggtaaaaagggatcactct
ggagttcaaaggacagaactcttgcctggtgaccgggaaaacctggccattcagacccgg
ggtggtccagaaaagcatgaagtaactggctgggtgctggtatctcctctaagtaaggaa
gacactggagaatacgagtgccacgcgtccaattcccaaggacaggcttcagcgtcggcc
aaaattacagtggttgatgccatacacgaaataccagtgaaaaaaggtgaaggtgctcag
ctataa

DBGET integrated database retrieval system