KEGG   Rattus norvegicus (rat): 289561
Entry
289561            CDS       T01003                                 

Gene name
Polr2b
Definition
(RefSeq) DNA-directed RNA polymerase II subunit RPB2
  KO
K03010  DNA-directed RNA polymerase II subunit RPB2 [EC:2.7.7.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    289561 (Polr2b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    289561 (Polr2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    289561 (Polr2b)
   03400 DNA repair and recombination proteins [BR:rno03400]
    289561 (Polr2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     289561 (Polr2b)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     289561 (Polr2b)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      289561 (Polr2b)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_2 RNA_pol_Rpb2_7 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5
Other DBs
NCBI-GeneID: 289561
NCBI-ProteinID: NP_001099472
RGD: 1309477
Ensembl: ENSRNOG00000024779
UniProt: G3V8Y5
Position
14
AA seq 1174 aa
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
NT seq 3525 nt   +upstreamnt  +downstreamnt
atgtatgacgccgacgaggatatgcaatatgatgaagatgatgatgaaatcactccagat
ttgtggcaggaagcatgctggatcgtgatcagttcttattttgatgaaaaaggcttggtc
agacagcagctggattcctttgacgagtttattcagatgtctgttcaaagaattgtggaa
gatgcaccaccgattgacctgcaggctgaagcccagcacgctagtggggaggttgaagag
ccgccaagatatttactgaagtttgaacaaatttacctctccaaacctactcattgggaa
agagatggtgccccttcaccaatgatgccaaatgaagccaggttaagaaatctcacgtac
tccgccccgctttacgtggacataacgaagacggtcattaaagagggtgaagagcagctg
cagactcagcaccagaaaaccttcatcgggaaaatccccattatgctgcgctccacgtat
tgcttgttgaatggcttaacagaccgtgacttgtgtgagctgaatgagtgtcctttggat
cctggtggctattttattattaatggatcagaaaaggttctgatagctcaagagaaaatg
gcaacaaacacagtctatgtgtttgccaaaaaggattccaagtatgcctatacaggagaa
tgccgctcatgcctagagaattcttcccgacccaccagtactatatgggttagcatgctg
gccagaggaggacagggtgcaaagaagagtgcaattggccagcgcatcgtggcgacatta
ccatatatcaagcaagaagttcccatcataattgtgttcagagcattaggctttgtgtct
gatagagatattttagagcacatcatttatgacttcgaagacccagagatgatggaaatg
gttaaaccatctctcgatgaagcatttgtcatccaagagcagaatgttgccttaaacttc
attggttcaagaggggcgaagcctggtgttactaaggagaaaagaattaaatatgcaaaa
gaagtcttacagaaagagatgcttccgcatgtcggtgtcagtgatttctgtgagaccaaa
aaggcctatttcttggggtacatggttcataggttacttctagcagccttgggtagaaga
gaactagatgacagagatcactatggcaacaagagattggatcttgctgggcctctgctt
gcgttcttatttagaggcatgtttaagaatttgctgaaagaagtacggatctatgcacag
aagtttattgaccgcggaaaggactttaacctagagttggcaattaagacaaggatcata
tccgatgggctaaaatactctttagccactgggaactggggtgaccagaagaaagctcac
caagccagagctggagtgtcgcaggtactgaaccgcctgacttttgcgtctactctttct
cacctgcgtcgtttaaactctcctattggcagagatggcaagctagcaaagccgagacag
ttgcataatacattgtgggggatggtgtgtcctgctgaaactccagagggccatgctgta
ggacttgtgaagaatttagccctgatggcttatatttcagttggatctcaaccttctcca
attttggaatttttggaagaatggagcatggaaaacttagaggaaatttcccctgcagct
attgccgatgcaaccaagatttttgttaatggctgctgggttggaatccataaagacccg
gaacaactcatgaacacactcaggaaattacggcgtcagatggacatcattgtatccgaa
gtttctatgatcagagatatccgcgagcgtgagattcggatctatacagacgcaggccgt
atttgtagaccacttctaattgtggaaaagcaaaagcttcttttgaagaagagacacatt
gaccagttgaaagagagagaatataacaactacagttggcaggatctggtagccagtggg
gtagtagagtatattgataccctggaagaagaaaccgtgatgcttgcaatgactccagat
gatttgcaggagaaagaagtagcttattgctccacctatacccactgtgagattcaccca
tcaatgattcttggcgtctgtgcatctattattccttttcctgatcataaccagtcccct
agaaacacgtaccagtctgctatgggcaagcaggctatgggagtttatatcaccaacttc
cacgttcggatggacaccttggcgcacgttctctactatcctcagaagccccttgtgact
acacggtctatggagtatctccggtttagagaactgccagcaggaatcaactcaattgtg
gccattgcatcatacacgggctataatcaagaagactctgttatcatgaatcgttcagct
gtggatcgaggctttttcaggtctgttttctaccgatcatacaaagaacaagagtctaaa
aaaggatttgatcaagaagaagtgttcgagaagcctacacgtgaaacatgtcagggcatg
aggcatgccatttatgacaagttggacgatgatggcttgatagcgccaggggtccgagtg
tcgggagacgatgttattataggcaaaacggtcaccctccctgagaacgaggatgagctg
gagagcaccaacaggcgctacaccaagagggactgcagcaccttcctcagaaccagtgag
acaggcattgtggaccaggtcatggtcactctcaaccaggaaggatataaattttgtaaa
ataagggtacgctctgttagaattccgcagatcggagacaaatttgctagccgacatggt
cagaagggtacttgtggtattcagtatagacaagaggacatgccgttcacttgtgaaggc
ataactcctgacatcatcataaacccccacgccatcccctctcggatgacgattggtcac
ttgattgaatgtctccaagggaaggtctctgcgaacaagggtgaaattggtgatgctact
ccgtttaatgatgctgtcaatgtgcagaagatttctaatcttttatctgactacggctac
catctcagaggaaatgaggtgctctacaatggattcactggtcgcaaaatcacatcgcag
atttttattggccccacttactaccagcgtttgaagcatatggtggatgacaaaattcat
tctcgtgctcgggggcccattcagattcttaacagacagcccatggagggcagatcgcgt
gatggtggcctgcgctttggagaaatggagcgagactgtcagatcgcacatggtgcagca
cagttcttaagagaaaggctgtttgaagcatcagatccgtatcaggttcacgtttgtaat
ctttgtggaataatggcaattgctaacaccaggactcacacatacgaatgcaggggatgc
cgcaataagacccagatctccttggtgcgaatgccgtatgcgtgcaagctgttgttccag
gagctcatgtccatgagcatcgcaccacggatgatgagtgtttag

DBGET integrated database retrieval system