KEGG   Rattus norvegicus (rat): 289586
Entry
289586            CDS       T01003                                 

Gene name
Spata18, spetex-1
Definition
(RefSeq) spermatogenesis associated 18
  KO
K22257  mitochondria-eating protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    289586 (Spata18)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    289586 (Spata18)
SSDB
Motif
Pfam: MIEAP Filament AAA_27 Leu_zip SPX
Other DBs
NCBI-GeneID: 289586
NCBI-ProteinID: NP_955406
RGD: 735208
Ensembl: ENSRNOG00000002120
UniProt: Q6AYL6
Position
14p11
AA seq 568 aa
MAENLKKLAQSESFLSLQDKVCFWANDYQTNSCDQNLNCCIELIEQVAKVQAQLFAILTA
TAQEGGHNEGVETIKSRLLPLLQTSFSSLGVGKIIQTEIRPIQDFQLRSKNRQSSLDQEQ
QQSDGDSFIESQPTQVQDDLTESGKNLEGTKNGSAISLLAAEEEINQLKKQLKSLQAQED
ARHKTSENRRAEISRTDRRPSGKRNSERPQDVVSNYEKHLKNLKDEIAVLSAEKSGLQAS
HRQTRSRSPSPGPRGPRGPRGRRRSRSHSRSHSRSHSRSHSHSNSHSNSRSNSPCTTVAK
IRSPSPNRSKMSSVARKAALLSRFSDAYSQARLDAQCLLRRCIDRAETVQRIIYIATVEA
FHIAKMAFRHFKIRVRKMLTPSHVGSNDFETAVSDYIVCHLDLYDSQSSVNDVIRAMNVN
PKISFPPEVDFCLLTDFIQEICCIAFAMQSLEPPLDIAFGADGEVFNEAKYRRSYDSDFT
APLVFYHVWPALMENDCVIMKGEAVTKRGAFWTTVRPVMRCRSRSLSPICPRSRFGISTV
HSCVTIPADDLVSRSRSPSPIRCTFARY
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggcagagaacttgaagaagctggcccaaagtgaatcttttctatcgctgcaggataaa
gtctgcttctgggcgaacgactaccagacaaactcctgtgatcaaaatctaaactgttgc
atcgaactcatcgaacaagtggcgaaggtgcaggcacagctctttgcaatcctcacagcg
acagcccaagaagggggacataatgagggtgttgagacaatcaagagtcgccttttgccc
ttgctgcagacttccttcagctctctaggcgtgggaaaaattattcagaccgagatccgt
cctatacaggatttccaacttagaagtaaaaacagacaaagttctctggatcaggaacaa
cagcagtcggatggtgattcgttcatagagagtcagccaacccaggttcaagacgatctg
actgaaagtggaaagaatcttgaaggaaccaaaaacggatcagccatatccctcctggct
gcagaagaggagataaatcagctaaaaaaacagctcaaatctcttcaagcccaggaggat
gcccgccacaaaacctcagagaatcgtcgcgctgagatttcaagaaccgatcgaaggcct
tcgggcaaacgaaattcagaacggccccaagatgtggtgtccaactatgagaaacacctg
aaaaatctcaaggacgagatagctgtcttgtctgctgagaaaagtggtctccaggcaagt
cataggcagaccaggagccggtctcctagcccaggcccccgaggcccccgcgggccccgt
ggccgccgccgtagccgcagccacagccgcagccacagccgcagccacagccgcagccac
agccacagcaacagccacagcaacagccgatccaatagtccctgcaccacagtggccaag
atcagaagcccgtccccaaaccgttccaaaatgtccagtgtggctcgcaaagcagctctc
ctgtcccgattcagcgacgcctattcccaggcccgcctggatgcacagtgcctactgcgg
cgttgcatcgacagggctgagacagtgcagcggatcatttacatcgccacagtggaggca
tttcacatagctaaaatggcattcaggcatttcaagatccgggtgaggaagatgctgacg
ccatcacacgtgggatccaatgactttgagaccgcagtctctgactatatcgtttgtcat
ctggacctatatgactctcaaagcagtgtcaatgatgtgatccgtgccatgaacgtcaac
cccaagatctcattccctccggaagttgacttctgcctcctcactgacttcatccaggag
atttgctgtattgcttttgcgatgcagtccttagagccaccccttgatatcgcatttggg
gcagacggagaagtctttaacgaggccaagtaccgccgcagctatgactcggacttcacg
gctcccttggtcttttatcacgtgtggcctgctctcatggagaacgactgtgtcattatg
aagggagaagctgtcaccaagagaggggctttttggaccactgttcgaccagtaatgcga
tgccgtagcaggagcttaagtcccatctgtcctcgtagtcgtttcggaataagcacggta
cattcctgtgtaaccattcctgcagacgaccttgtatctcggagtcgaagtccttcgcca
ataaggtgtacattcgcaaggtattaa

DBGET integrated database retrieval system