KEGG   Rattus norvegicus (rat): 289608Help
Entry
289608            CDS       T01003                                 

Gene name
Gnpda2
Definition
(RefSeq) glucosamine-6-phosphate deaminase 2
  KO
K02564  glucosamine-6-phosphate deaminase [EC:3.5.99.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00520  Amino sugar and nucleotide sugar metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    289608 (Gnpda2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.6  glucosamine-6-phosphate deaminase
     289608 (Gnpda2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-GeneID: 289608
NCBI-ProteinID: NP_001099475
RGD: 1305521
Ensembl: ENSRNOG00000002177
UniProt: B5DEZ6
Position
14q11
AA seq 276 aa AA seqDB search
MRLVILDNYDLASEWAAKYICNRIIKFKPGQDRYFSLGLPTGSTPLGCYKKLIEYHKSGN
LSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDA
FEEKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSK
VPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCD
EDATLELRVKTVKYFKGLMHVHNKLVDPLCSMKEGD
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttgtaattcttgataactatgacttggccagtgagtgggcagccaagtacatc
tgcaatcgtatcatcaaattcaagcctggacaggacagatacttttcactgggcttacca
acagggagcacacctttaggatgttataaaaaactaatagaataccacaagagtggaaac
ctttcatttaaatatgtgaagacttttaacatggatgaatatgttggacttccaagaaac
catcccgaaagctaccattcttatatgtggaataacttctttaagcatatcgacatagat
cctaataatgctcacatcctcgatgggaacgctgctgatttgcaggcagagtgtgatgca
tttgaggagaaaataaaagaagccggaggaatagatctttttgttggaggaataggtcca
gatggtcatatcgctttcaatgagccaggatccagtttagtatcaagaacaagattaaag
actctagcaatggacaccattttagcaaatgcaaaatattttgatggagatttatcaaaa
gtaccaaccatggctctaactgttggtgtggggacagtgatggatgccagggaggtgatg
atcctcataacaggtgcacacaaggcgttcgcgctgtacaaagccatcgaggaaggcgtc
aatcacatgtggactgtgtccgctttccagcagcatccccggactatttttgtatgtgac
gaggatgctactttagagttaagagttaaaactgtgaaatactttaaaggtttaatgcat
gtgcacaataaacttgtggacccactatgcagtatgaaagaaggggactga

DBGET integrated database retrieval system