KEGG   Rattus norvegicus (rat): 289668
Entry
289668            CDS       T01003                                 

Gene name
Lap3
Definition
(RefSeq) cytosol aminopeptidase
  KO
K11142  cytosol aminopeptidase [EC:3.4.11.1 3.4.11.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00330  Arginine and proline metabolism
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    289668 (Lap3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    289668 (Lap3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    289668 (Lap3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     289668 (Lap3)
    3.4.11.5  prolyl aminopeptidase
     289668 (Lap3)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   289668 (Lap3)
SSDB
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Other DBs
NCBI-GeneID: 289668
NCBI-ProteinID: NP_001011910
RGD: 1307985
Ensembl: ENSRNOG00000003289
UniProt: Q68FS4
Position
14
AA seq 519 aa
MYLLPLPAAARVALRRLGVRGLWDRGLSTADMTKGLVLGIYSKDKDDDVPQFTSAGENFN
KLVSGRLREMLNISGPPLKAGKTRTFYGLHQDFPSVVVVGLGKRSAGVDDQENWHEGKEN
IRAAVAAGCRQVQDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGS
GDLEAWEKGVLFASGQNLARQLMESPANEMTPTRFAEVIEKNLKSASSKTEVHIRTKSWI
EEQEMGSFLSVAKGSEEPPVFLEIHYTGSPNATEAPLVFVGKGITFDSGGISIKASANMD
LMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRARNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
ASVETGDRVWRMPLFEHYTRQVIDCQLADVNNLGKYRSAGACTAAAFLREFVTHTKWAHL
DIAGVMTNKDEIPYLRKGMSGRPTRTLIEFLLRFSKDSS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgtacttgctgcctcttccggcagccgcgcgagtcgcgctccgcaggctgggagtgaga
ggtctctgggatcggggtctgtccaccgcagacatgacgaagggccttgttttaggaatt
tattccaaagacaaagatgatgacgtaccacagtttacaagtgcaggagagaattttaat
aagttggtgtctggaaggctgagggaaatgttgaacatatcgggacctcctctcaaggca
ggcaaaacccgaaccttctatggtctgcatcaggacttccccagcgtggtggttgtcggc
cttggcaagagatcggctggtgtcgatgaccaggaaaactggcacgaaggcaaggagaac
atccgagctgctgttgcagcgggatgcaggcaggtccaagacctggagctgccgtcggtg
gaggtggatccctgtggagatgctcaggctgctgcggaaggagctgtgcttggcctctac
gagtatgatgacctaaagcagaaaaagaaggtggctgtgtcggccaagctccatggaagt
ggtgacctcgaggcctgggagaaaggggtcctctttgcttctgggcagaacttggcccgc
cagctgatggagtctccagccaatgaaatgacaccaaccagatttgccgaagttattgaa
aaaaatctcaaaagtgccagtagtaaaaccgaggtccatatcagaaccaaatcctggata
gaggaacaagaaatgggttcattcctaagtgtagccaaggggtctgaagaaccaccagtc
ttcttggaaatccactatactggcagccccaatgcaactgaagcacccctggtgtttgtg
ggaaagggcattacctttgacagcggaggtatctccatcaaggcttctgcaaatatggac
ctcatgagggctgacatgggaggagcagcaacaatatgctcggccattgtgtctgcagca
aagctcaatctgcccattaatatcataggtttggcccctctttgtgaaaacatgcctagc
ggcaaggccaacaaaccaggggatgttgtcagagccaggaatgggaagactatccaggtc
gacaacactgatgccgagggcaggctcatcctggccgacgcactctgctatgcacacacc
ttcaatcccaaggtcatcatcaatgctgccactttaacaggtgccatggacgtagccctg
ggatcaggtgccactggagtctttaccaattcatcctggctgtggaacaaactatttgag
gccagtgtagaaactggggaccgagtctggaggatgcccctctttgagcattatacaaga
caagtcatagattgccaacttgctgatgtgaacaatcttggaaaatacagatctgcaggt
gcgtgcacagctgcggcattcctgcgagagtttgtgactcatacaaagtgggcacattta
gacatagccggtgtgatgaccaacaaggacgagattccctatctgcggaagggaatgagt
gggagacccacaaggactctgattgagttcttacttcgcttcagcaaagacagttcttag

DBGET integrated database retrieval system