KEGG   Rattus norvegicus (rat): 289687Help
Entry
289687            CDS       T01003                                 

Gene name
Gba3
Definition
(RefSeq) glucosidase, beta, acid 3
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    289687 (Gba3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     289687 (Gba3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 289687
NCBI-ProteinID: NP_001099480
RGD: 1309539
Ensembl: ENSRNOG00000024634
UniProt: G3V8Y1
Position
14q11
AA seq 284 aa AA seqDB search
MGIFAPGVPHIGIGGYQAAHNLIKAHARSWHSYDSLFREEQKGFVSLSLFFCWLEPADPN
SEIDQEATKRAINFHLDFFAKPIFIDGDYPDVVKSQVASMSKKQGYPSSRLPEFTEEEKK
MIKGTADFFAVQYYTTRLVRHQENKKRELGFLQDVEIEFFPNPFWKNVGWIYVVPWGIRK
LLKYIKDTYNNPVIYITENGFPQCDPPSLDDTQRWEYFRQTFQELFKVYCAWSLLDNFEW
NNGYSRRFGLFHVDFEDPARPRTPYRSAKEYAKVIRDNGLAGAM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgggtatctttgctcctggtgtgcctcatattgggattgggggttatcaagcagctcat
aatttgattaaggctcatgccagatcctggcacagctatgattctttattccgagaagaa
cagaagggttttgtgtccctatcattatttttttgctggctagaaccagcagatcccaac
tcagagattgaccaggaagctactaagagggccatcaatttccacttggatttctttgct
aaacccatatttattgatggtgattatccagatgttgtcaagtcccaggttgcctccatg
agcaaaaagcaaggctatccatcatcaaggcttccagaattcacagaggaagagaagaaa
atgatcaaaggcactgccgatttctttgctgttcaatattatacaactcgcttagtcagg
catcaggagaataagaagagagaactgggcttccttcaggatgtggagattgaatttttt
cctaatccattttggaaaaatgtgggttggatctacgtggtaccatggggaatacgaaaa
ctactgaaatatattaaggatacatataataaccctgtaatttacatcaccgagaatggg
tttccccagtgtgaccccccatctcttgatgacactcagcgttgggagtatttcagacag
acatttcaggaactattcaaagtctactgtgcgtggtcgcttctggataactttgagtgg
aacaatggatacagcagacggtttggtctcttccacgttgattttgaagatcccgctaga
ccccggactccatacagatcagccaaggaatatgccaaggtcatcagagacaatggcctg
gcaggcgctatgtag

DBGET integrated database retrieval system