KEGG   Rattus norvegicus (rat): 289717Help
Entry
289717            CDS       T01003                                 

Gene name
Tada2b, ADA2B, RGD1561605
Definition
(RefSeq) transcriptional adaptor 2B
  KO
K15127  transcriptional adapter 2-beta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    289717 (Tada2b)
   03036 Chromosome and associated proteins [BR:rno03036]
    289717 (Tada2b)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     289717 (Tada2b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    STAGA complex
     289717 (Tada2b)
    TFTC complex
     289717 (Tada2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 ZZ zf-B_box SWIRM
Motif
Other DBs
NCBI-GeneID: 289717
NCBI-ProteinID: NP_001163926
RGD: 1561605
Ensembl: ENSRNOG00000027326
UniProt: B5DFL8
Position
14q21
AA seq 420 aa AA seqDB search
MAELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFT
LWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHYVSMYIHGNLG
KACIPDTIPNRVTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQD
AETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNIARDYNLVPAFLGKDKKEK
EKTLKRKITKEEKELRLKLRPLYQFMSCKEFDDLFENMHKEKMLRAKIRELQRYRRNGIT
KMEESAEYEAARHKRERRKENKNLASSKRGKEDGKDSEFAAIENLPGFELLSDREKVLCS
SLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWISRDAS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgggtaagaagtactgcgtgtactgcttggccgaggtgagcccgctgcgc
ttccgctgcacagagtgccaggacatcgagctgtgcccggagtgcttctcggccggcgcg
gagatcggccaccaccgccgctaccacggctaccagctggtagacggcgggcgattcaca
ctctggggtcctgaggcagagggcggctggaccagccgcgaggagcagctgctactggac
gccatcgagcagttcggcttcggcaactgggaagacatggctgctcatgttggtgcttct
cggactccccaggaagtgatggagcactacgttagtatgtatatccatgggaacttgggc
aaagcctgtatccctgacaccatccccaaccgggtgacagatcatacctgccccagtgga
ggtcctctctcacccagccttaccacaccattgcccccattggacatctcagtggctgag
cagcagcagctgggctacatgccgctgcgagatgactatgagatcgagtacgaccaggat
gctgagacgctcatcagtgggctgtctgtgaactatgatgatgatgatgtggagattgag
ctcaaacgtgctcatgtagacatgtatgtgcggaagctgaaggagaggcagcgccggaag
aatattgcccgagactataacttggtaccagccttcctgggcaaggacaagaaggagaaa
gagaagacattgaagagaaagatcaccaaggaggagaaagagctgcggctgaaactacgg
ccactctaccagttcatgtcctgcaaagaatttgacgatttatttgaaaacatgcacaaa
gagaagatgctccgcgccaagatcagagagctgcagcggtaccggcgcaatggcattacg
aagatggaggagtcggctgaatacgaggctgccagacacaaacgggagaggaggaaggag
aacaaaaacctggccagctctaaaagggggaaggaggatggcaaagacagcgagtttgca
gccatcgagaatcttccagggtttgagctgctgtcagatcgggagaaggttctctgtagc
tctttgaacttgagtcctgcacgctatgtgactgtgaagactattataattaaagatcac
ctccagaagcggcaagggatcccctctaaaagtcgccttcccagttatctggacaaggtc
ctaaagaaaaggattttaaatttcctcacagaaagtgggtggatatctagggatgcttcc
tga

DBGET integrated database retrieval system