KEGG   Rattus norvegicus (rat): 289727
Entry
289727            CDS       T01003                                 

Gene name
Nat8l
Definition
(RefSeq) N-acetylaspartate synthetase
  KO
K18309  aspartate N-acetyltransferase [EC:2.3.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00250  Alanine, aspartate and glutamate metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    289727 (Nat8l)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.17  aspartate N-acetyltransferase
     289727 (Nat8l)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG Acetyltransf_3 FR47 Acetyltransf_15 Acetyltransf_8 DUF2156 DUF898
Other DBs
NCBI-GeneID: 289727
NCBI-ProteinID: NP_001178610
RGD: 1305719
Ensembl: ENSRNOG00000049351
UniProt: D3ZVU9
Position
14
AA seq 299 aa
MHCGPPDMVCETKIVATEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPPAAGPQP
HGGTGGAGPPEGRGVCIREFRAAEQEAARRIFYDGILERIPNTAFRGLRQHPRTQLLYAL
LAALCFAVTRSLLLTCLVPAGLLALRYYYSRKVILAYLECALHTDMADIEQYYMKPPGSC
FWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRRVLEFAMLHNYSA
VVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcattgtgggcctcccgacatggtctgcgagacgaagatcgtggctacggaggaccat
gaggcactgccgggggccaagaaggacgcgctgctcgccgccgccggagccatgtggccc
ccgctgcccgccgcgcccgggccggctgccgcacccccacccgcggcaggtccccagccc
cacggaggcaccgggggcgcggggccgccggaggggcgcggcgtgtgcatccgcgagttc
cgcgcagccgagcaggaggcggcgcgccgcatcttctacgacggcatcttggagcgcatc
cccaacacggctttccgaggcctgcggcagcacccgcgcacccagctgctctacgccctg
ctggcggccctctgttttgctgtgacccgctcactgctgctgacatgcctggtgccggcc
gggctcctggccctgcgctactactacagtcgcaaggtgattctggcctacctggagtgt
gcgctgcacacggacatggctgacattgaacagtactacatgaagccacctggttcctgt
ttctgggtggctgtgctggacggcaatgttgtgggcatcgtggcggctcgggcccatgag
gaagacaacacagtggagctgctccgcatgtccgtggactcgcgcttccgcggcaaaggc
atcgccaaggccctgggcaggagggtgttggagtttgccatgctgcacaactactctgca
gtggtactgggcaccacagccgttaaggtggccgcccacaagctctatgagtcactgggc
ttcagacacatgggcgcgagtgatcactacgtgctgcctggcatgaccctctcgctggcc
gagcgcctcttcttccaggtccgctaccaccgctaccgcctgcagctgcgcgaggagtga

DBGET integrated database retrieval system