KEGG   Rattus norvegicus (rat): 289752Help
Entry
289752            CDS       T01003                                 

Gene name
Ewsr1
Definition
(RefSeq) EWS RNA-binding protein 1
  KO
K13209  RNA-binding protein EWS
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    289752 (Ewsr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    289752 (Ewsr1)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    289752 (Ewsr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RanBP RRM_1
Motif
Other DBs
NCBI-GeneID: 289752
NCBI-ProteinID: NP_001020803
RGD: 1307258
Ensembl: ENSRNOG00000009437
UniProt: B1WC50
Position
14q21
AA seq 655 aa AA seqDB search
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQSTAT
YGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGT
QPAYPAYGQQPAATAPTRPQDGNKPAETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP
MQPVTAPPSYPPTSYSSSQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY
PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSLSGPDNR
GRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLDLGLPIDPDEDSDNS
AVYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPP
TAKAAVEWFDGKDFQGSKLKVSLARKKPPLNSMRGGMPPREGRGMPPPLRGGPGGPGGPG
GPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECN
QCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRG
GRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccacggattatagtacctatagccaagctgcagcccagcagggctacagtgct
tacaccgcccagccaactcaaggatatgcacagaccacccaggcatatgggcaacaaagc
tatggaacctatggacagcctactgatgtcagctatacccaggctcagagcactgccacc
tacgggcagactgcatatgcaacttcttatggacagcctcccactggttataccactcca
actgccccccaggcgtacagccagcctgtccaaggatatggcactggggcttatgacacc
accactgctaccgtcaccacaacgcaggcctcttatgcagctcagtctgcatacggcacc
cagcctgcctacccagcctatggccagcagccagcagccactgcacccacaagaccacag
gatggtaacaagcctgctgagactagtcaacctcaatctagcacagggggttataatcaa
cccagcctaggatatggacagagtaactacagttatccccaggttcctgggagctacccg
atgcagccagtcaccgcacctccatcttatcctcctaccagctactcctcttcacagcca
actagttacgatcagagcagttactctcagcagaacacctacgggcagccgagcagctat
ggacagcagagtagctatggtcaacaaagcagctatgggcagcagcctcccactagttac
ccccctcagactggatcctacagccaggctccaagtcaatatagccaacagagcagcagc
tacgggcagcagagttcattccgacaggaccaccccagtagcatgggtgtttatgggcag
gagtctggaggattttccggaccaggagagaaccggagcttgagtggccctgataaccgg
ggcaggggaagagggggatttgatcgtggaggcatgagcagaggtgggcggggaggagga
cgcggtggaatgggcgctggagagcgaggtggcttcaataagcctggtggacccatggat
gaaggaccagatctcgatctaggccttcctatagatcccgatgaagactctgacaacagt
gcagtttatgtgcaaggattaaatgacagtgtgactctggatgatctggcagacttcttt
aagcagtgtggggttgtcaagatgaacaagagaactggacaacccatgatccatatctac
ctggataaggagacaggaaagcctaaaggtgatgccacagtgtcctatgaagatccacca
actgccaaggctgccgtggaatggtttgatgggaaagactttcaaggaagcaaacttaaa
gtttctcttgcccgaaagaagcctccactgaacagcatgcggggtggcatgccacctcgt
gagggcagagggatgccaccgccgcttcgtggaggtcctggtggcccaggaggtcctggg
ggacccatgggtcgcatgggaggccgtggaggagacagaggaggcttccctccaagaggg
ccccgaggctccagagggaacccctctggaggaggaaatgtccagcaccgagctggagac
tggcagtgtcccaatccgggctgtggaaatcagaacttcgcctggagaacagaatgcaac
cagtgtaaggcccctaagcccgagggcttcctcccgccaccctttccacctccgggtggt
gatcgtggccgaggcggccctggtggcatgcgaggaggaagaggtggactcatggaccgt
ggtggtcctggaggaatgttcagaggtggcagaggtggagaccgagggggcttccgaggt
ggccgtggcatggaccgaggtggctttggtggaggaagacgaggtggtcctggggggcct
cctggacctttaatggaacagatgggaggaagaagaggcggacgtggaggacctgggaaa
atggataaaggcgagcaccgtcaggaacgcagagaccggccctactag

DBGET integrated database retrieval system