KEGG   Rattus norvegicus (rat): 289754
Entry
289754            CDS       T01003                                 

Gene name
Xbp1, HTF
Definition
(RefSeq) X-box binding protein 1
  KO
K09027  X box-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    289754 (Xbp1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    289754 (Xbp1)
   05012 Parkinson disease
    289754 (Xbp1)
   05014 Amyotrophic lateral sclerosis
    289754 (Xbp1)
   05017 Spinocerebellar ataxia
    289754 (Xbp1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    289754 (Xbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    289754 (Xbp1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    289754 (Xbp1)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 bZIP_Maf KASH_CCD CASP_C YabA TSC22 Fez1 FtsL DivIC Atg14 Macoilin 5_nucleotid GAS
Other DBs
NCBI-GeneID: 289754
NCBI-ProteinID: NP_001004210
RGD: 1303073
Ensembl: ENSRNOG00000010298
UniProt: Q9R1S4
Position
14q21
AA seq 267 aa
MVVVAAAPSAASAAPKVLLLSGQPASGGRALPLMVPGPRAAGSEASGTPQARKRQRLTHL
SPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLQLENQLLREKTHGLV
IENQELRTRLGMNALVTEEVSEAESKGNGVRLVAGSAESAALRLRAPLQQVQAQLSPPQN
IFPWILTLLPLQILSLISFWAFWTSWTLSCFSNVLPQSLLIWRNSQRSTQKDLVPYQPPF
LCQWGPHQPSWKPLMNSFVLTMYTPSL
NT seq 804 nt   +upstreamnt  +downstreamnt
atggtggtggtggcagcggcgccgagcgcggcctcggcggcccccaaagtgctactccta
tctggtcagcccgcctccggcggccgagcgctgccgctcatggttccgggcccgcgagcc
gcagggtcggaggcgagcgggacaccgcaggctcgcaagcggcagcgcctcacgcacctg
agcccggaggagaaagcgctgcggaggaaactgaaaaacagagtagcagcacagactgcg
cgagatagaaagaaagcccggatgagcgagctggagcagcaagtggtggatttggaagaa
gagaaccagaaactccagctagaaaatcagcttttacgagagaaaactcatgggcttgtg
attgagaaccaggagttaaggacacgcttggggatgaatgccctggttactgaagaggtc
tcagaggcagagtccaaggggaatggagtaaggctggtggccgggtctgctgagtccgca
gcactcagactacgtgcgcctctgcagcaggtgcaggcccagttgtcacctccccagaac
atcttcccatggattctgacgctgttgcctcttcagattctgagtctgatatccttttgg
gcattctggacaagttggaccctgtcatgtttttcaaatgtccttccccagagtctgcta
atctggaggaactcccagaggtctacccagaaggacctagttccttaccagcctcccttt
ctctgtcagtggggacctcatcagccaagctggaagccattaatgaactcattcgttttg
accatgtatacaccaagcctctag

DBGET integrated database retrieval system