KEGG   Rattus norvegicus (rat): 289827
Entry
289827            CDS       T01003                                 

Gene name
Ugp2
Definition
(RefSeq) UDP-glucose pyrophosphorylase 2
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
rno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
rno_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    289827 (Ugp2)
   00052 Galactose metabolism
    289827 (Ugp2)
   00500 Starch and sucrose metabolism
    289827 (Ugp2)
   00520 Amino sugar and nucleotide sugar metabolism
    289827 (Ugp2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     289827 (Ugp2)
SSDB
Motif
Pfam: UDPGP DUF5663 DUF1647
Other DBs
NCBI-GeneID: 289827
NCBI-ProteinID: NP_001019914
RGD: 1310210
Ensembl: ENSRNOG00000008079
UniProt: Q4V8I9
Position
14q22
AA seq 508 aa
MSRFVQDLSKAMSQDGASQFQEVILQELELSVKKELEKILTTATSHEFEHTKKDLDGFRK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNH
CRVKIYTFNQSRYPRINKESLLPIAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFI
EEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEG
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLD
GGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtcgagatttgtacaagatcttagcaaagctatgtctcaagatggtgcttctcagttc
caagaggtcattctccaagaactagaattatctgtgaagaaagaattagaaaaaatactt
accacagcaacctcacatgagtttgagcacactaagaaagatcttgatggatttcggaag
ctatttcacagatttttgcaagaaaaggggccttctgtagactggggtaaaatccagaga
cctccggaagattcgattcaaccctatgaaaagataaaggccagaggcttgcctgataac
atatcttctgtgttgaacaaactggtggtagtgaaactcaatggtggtttgggaaccagc
atgggctgcaaaggccctaaaagtctgattggtgtaagaaatgagaatacctttttggat
ctaaccgttcagcaaattgaacatctgaacaaaacctataatacagatgtcccgctcgta
ttaatgaattcttttaacacggatgaggatacaaaaaaaatactccagaagtacaatcat
tgtcgtgtgaaaatctacaccttcaatcaaagcaggtacccgaggattaataaggaatct
ctacttcctatagcaaaggacgtatcttattcaggggaaaatactgaagcttggtaccct
ccaggacatggggacatctatgccagtttctacaactctggtttgctcgacaccttcata
gaagaaggcaaggagtatatttttgtgtctaacatagacaacctgggtgccacagtggat
ctttatattcttaatcatctaatgaacccacccaatgggaaacgctgtgaatttgtcatg
gaagtcacaaataaaacacgggcagacgtaaagggtgggacactcactcagtacgaaggc
aaactgaggctggtggagattgctcaggtgcccaaagcacacgttgatgagttcaagtct
gtgtcaaaatttaaaatatttaacacaaacaacctatggatctccctggccgccgttaaa
agactgcaggaacagaatgctattgacatggaaatcattgtgaacccaaagacattggat
ggaggcctgaatgttattcagttagaaactgcagttggagcggcaattaaaagtttcgag
aattctttaggtattaatgttccaaggagtcgttttctgcctgtgaaaaccacatcagat
ctcttacttgtgatgtcaaacctctacagccttaacgcaggatctttgaccatgagtgaa
aagcgtgaatttcctacggtacctttggttaaattaggcagttcttttaccaaggttcaa
gattatctaagaaggtttgaaagtatacccgatatgttggaactggaccacctcacggtt
tcaggagatgtaacatttggaaaaaatgtttcattaaagggaacagttatcatcattgca
aatcatggtgacagaattgacatccccccaggagcagtgttagagaacaagattgtatct
gggaaccttcggatcctggaccactga

DBGET integrated database retrieval system