KEGG   Rattus norvegicus (rat): 289833
Entry
289833            CDS       T01003                                 

Gene name
Fam161a, RGD1304999
Definition
(RefSeq) family with sequence similarity 161, member A
  KO
K16772  protein FAM161A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    289833 (Fam161a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    289833 (Fam161a)
SSDB
Motif
Pfam: UPF0564 TMEM51
Other DBs
NCBI-GeneID: 289833
NCBI-ProteinID: NP_001013898
RGD: 1304999
Ensembl: ENSRNOG00000009881
UniProt: Q6AY14 A0A0A0MXW0
Position
14q22
AA seq 496 aa
MWQIRASAGCHSSPGKDKEVTLENTMNFSDIYHSDEEYFRKLKDLRAAHAEAMVKLEKMY
QDKLTMKDIQAALVGDDSSSSASEKSCSHPALSATSLSEPDLDRSSSLSTTTDELPDLEK
KTPGEIGTRSYAKELINNMWNDFSVEDYTQYDSDLQTAKKNRKKPKAWTPRITVPVPFEM
TVREQKRREKASDAQETREKMLKRNEDDAECKKKFRANPVPSRLLLPLYEDLVKQNEERR
KKTRERSKAALLASQKPFKFIAREEQKQAIREKKLRELCRAKKKPKQFKARPVPRFIYRP
PANVKPKREELYGDSRTQPKARDVLQSSPWPSHSTYRAFRDPRSPAMPRGKHRHRRLSPS
DQGLEKWKEPFSEQSFRNCPVLCDQCCLYESLCDSNKRQKILADIRMGEEILKETRRPNP
SPRHKSPRRSAHASARPCEYSPPMPTASSRGREQAIRRSEKARMKEYWQELEEQDKKLQK
RPMLFERVSQVVFIGI
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgtggcagatacgggcgtcggcaggctgtcacagctctcctgggaaggacaaagaggtg
acattggagaacactatgaacttctctgatatttaccactctgatgaagagtacttcagg
aaactcaaagacctgagggctgcccatgcagaggccatggtaaaattagagaaaatgtac
caggacaagctaactatgaaggacatccaggcagcgctcgttggggatgattcttctagt
tctgcatcggaaaagagctgctcacatcctgccttgtcggcgacctcgctttcagagcct
gacctagaccggtcgtcctccttgtccacaactactgatgagttgcccgacctagagaaa
aagactcctggggaaatcggaacaaggtcctatgccaaggagctcataaacaacatgtgg
aacgacttttctgttgaagattatactcagtatgactctgacctccaaacagccaagaaa
aacaggaagaaacctaaagcctggacgcccaggattacagtgccggtgccctttgaaatg
acggtaagagagcagaagcggagagagaaggcctcggatgctcaggaaaccagggagaag
atgctcaagaggaatgaggacgatgcagagtgtaagaagaaattccgagccaatccagtt
ccttcccgcctgctccttcccctttatgaggatctagtcaagcagaacgaggagcgtcgg
aagaagacccgggagaggagcaaagccgcactcctggcctcccagaagccctttaagttc
attgcgagggaggaacagaagcaagcaatccgtgagaagaagctgagagaactttgtagg
gctaagaagaaaccgaagcagtttaaagccaggcctgtgcctcgttttatttacagacca
cctgcgaatgtcaagccaaagagggaagagctctatggggacagcaggacacagccaaag
gccagagatgtgctgcagagttcgccttggcccagtcactccacttacagagctttcagg
gaccccagaagtcctgcaatgccaaggggtaaacacaggcataggcgcctgagccccagt
gaccaaggcttggagaaatggaaggaacccttctctgaacagagctttcggaactgcccg
gtgctttgtgaccagtgttgtctttacgaatccttatgtgactccaataaaagacagaaa
atcttggcagacatccgaatgggtgaggaaattttgaaagaaacacgcaggcctaatcct
tctcctaggcataaatcccccagaagaagcgcgcacgccagcgccaggccttgtgaatac
agccctccgatgcccaccgcgtcttcccgagggcgcgagcaagccatcagaaggagcgaa
aaggccaggatgaaagaatattggcaagaattggaggagcaagataaaaaattgcaaaag
aggccgatgctgtttgaaagagtctcccaggttgtgtttattggaatttag

DBGET integrated database retrieval system