KEGG   Rattus norvegicus (rat): 289878Help
Entry
289878            CDS       T01003                                 

Gene name
Pde6b
Definition
(RefSeq) phosphodiesterase 6B
  KO
K13756  rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta [EC:3.1.4.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    289878 (Pde6b)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    289878 (Pde6b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     289878 (Pde6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3
Motif
Other DBs
NCBI-GeneID: 289878
NCBI-ProteinID: NP_001099494
RGD: 1311039
Ensembl: ENSRNOG00000000065
UniProt: D3ZDI8
Position
14p22
AA seq 856 aa AA seqDB search
MSLSEEQVRSFLDGNPTFAHQYFEKKLSPENVAGACEGGCLVDCGSLRELCQVEESAALF
ELVQDMQESVNMERVVFKVLRRLCTILHADRCSLFMYRQRNGVAELATRLFSVQPDSLLE
DCLVPPDSEIVFPLDIGIVGHVAQTKKMINVQDVAECPHFSPFADELTDYVTKNILSTPI
MNGKDVVAVIMAVNKLDGPCFTSEDEDVFTKYLNFATLNLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCDRYSVGLLDMTKEKEFFDVWPVLMGEAQPY
SGPRTPDGREIVFYKVIDYILHGKEDIKVIPTPPADHWALTSGLPTYVAESGFICNIMNA
SADEMFNFQEGPLDESGWVIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDDQDEVLMES
LTQFLGWSVLNTDTYDKMNKLENRKDIAQDMVLYHVRCDKDEIQEILPTRDRLGKEPADC
EEDELGKILKEELPGPTKFDIYEFHFSDLECTELELVKCGIQMYYELGVVRKFQIPQEVL
VRFLFSVSKAYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDID
HRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLAEESLNIYQNLNRRQHEHVIHLM
DIAIIATDLALYFKKRTMFQKIVDESKNYEDKKSWVEYLSLETTRKEIVMAMMMTACDLS
AITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCT
FVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEEKKKEEDRVAAKKAGTE
ICNGGPAPKSSTCCIL
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcagtgaggaacaagtacgcagcttcctggatgggaaccccacctttgcccac
caatactttgagaagaagctgagccctgaaaatgtggcaggggcctgtgaaggtggttgc
ctggtggactgtggcagcctacgagagctgtgccaggtggaagagagtgcagcgctgttt
gaactggtgcaggacatgcaagagagcgtcaatatggaacgcgtggtcttcaaggttctg
cggcgtctctgcaccatcctgcatgctgaccgctgcagcctctttatgtaccgccagcgc
aatggcgtagctgaacttgctactcggctcttcagtgtgcagcccgacagcctcctggag
gattgcctggtgccccctgactctgagatcgtcttccctctggacattgggattgtgggc
catgtggctcagaccaagaagatgataaacgtgcaggatgtggcagagtgtcctcacttc
agcccatttgccgatgagctcaccgactacgtgacaaagaacattctgtccacgccaatc
atgaatggcaaagatgttgtggctgtgattatggcagtgaataaattggatggtccatgc
ttcacgagcgaagacgaagatgttttcacgaagtacctgaattttgctacattaaacctg
aagatctatcacctaagctacctccacaactgtgaaacacgcagaggccaggtgcttctc
tggtcagccaataaggtatttgaagaactgacagacattgaaagacagttccacaaggcc
ttctacactgtccgggcctatctaaactgtgaccggtactcagtgggcctcctggacatg
accaaggagaaggaattctttgatgtgtggcctgtgctgatgggggaagcccagccatac
tcgggcccacgaacaccagatggccgggaaattgtcttctacaaagtcattgattatatc
ctccatggcaaagaagacatcaaagtcattcccacacctccagctgatcactgggccctg
accagtggccttcccacctatgtggcagaaagtggctttatctgtaacatcatgaacgct
tcagctgatgaaatgttcaactttcaggaagggcccctggatgagtcagggtgggtgatc
aagaatgttctctccatgcccattgtcaacaagaaggaggagattgtgggggtagccacc
ttctacaacaggaaagatggaaagcccttcgatgatcaagatgaagtccttatggagtct
ctgacacagttcctgggatggtcagtgttgaacacagacacctatgacaagatgaacaag
ctggagaaccgtaaggacatcgcccaggacatggttctgtaccatgtgagatgcgacaag
gatgaaatccaggaaatcttgccaacaagggatcgcctggggaaggaacctgctgactgt
gaggaggatgagctggggaaaatcttgaaggaggaacttccagggcctaccaagtttgac
atctatgagttccacttctctgatctggagtgcaccgagctggagctagtcaaatgtggc
atccagatgtactacgagctgggtgtagtccgaaagttccagattccccaggaggtcctt
gtgcgcttcctattctctgtcagcaaagcttaccgaagaatcacctaccataactggcgc
catggcttcaatgtggcccagaccatgtttaccctactcatgacaggcaaactgaagagc
tattacacagacctagaggccttcgccatggttacagctggcctgtgccacgacatcgac
caccgtggcaccaacaacctgtaccagatgaaatctcagaatcctctagccaaactacat
ggctcctcaattctggaaaggcaccacttggagtttgggaagtttctgttggcagaggag
agcctgaatatctaccagaacctgaaccggcggcagcatgaacatgtgatccacctcatg
gacatcgccatcattgccactgacctggccctctacttcaagaagagaaccatgttccag
aagattgtggatgaatctaagaactatgaagataagaagagctgggttgagtacttgtcc
ctagagaccacacgaaaggagatcgtcatggccatgatgatgactgcatgtgacctgtct
gctatcaccaagccctgggaagtccagagcaaggttgctcttctggtggctgctgagttc
tgggaacagggggacctggagaggactgtcctggaccaacagcccattcccatgatggac
cggaacaaagcagctgagctccccaagctacaagttggcttcatcgacttcgtatgtact
ttcgtgtacaaggaattttctcgatttcacgaagagatcctgcccatgtttgaccgactg
caaaataacagaaaggagtggaaagctctagctgatgagtatgaggccaaagtcaaggca
ctggaggaagagaagaagaaggaagaagacagagtagcagccaagaaagcgggcacagaa
atttgcaatggtggtccagcacccaagtcctcgacctgctgtattctataa

DBGET integrated database retrieval system