KEGG   Rattus norvegicus (rat): 289949Help
Entry
289949            CDS       T01003                                 

Gene name
Fam3d, Oit1
Definition
(RefSeq) family with sequence similarity 3, member D
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ILEI
Motif
Other DBs
NCBI-GeneID: 289949
NCBI-ProteinID: NP_001099497
RGD: 1305512
Ensembl: ENSRNOG00000007320
UniProt: D3ZZ49
Position
15p14
AA seq 216 aa AA seqDB search
MRVAGLIRVVAFIFTVVTMWIFLRSYTNFNRKTIRLPRWLDTPKFKCGLSKSCLNNFFAF
KISSGAANVVGPSMCFEDEIIMSPVRNNVGRGLNIALVNGTTGRVIRKASFDMYSGEPQP
LLDFLTEIPDSTLVLVASYDDPGTKMNDKIKTLFTNLGSSYAKQLGFRDSWVFVGAKDLR
SKSPYEQFLKNNPETNKYEGWPELLELEGCVPKKVM
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagagtggcaggtctgattcgtgttgtggctttcattttcaccgtggttaccatgtgg
atcttcctccgcagctataccaacttcaacaggaaaaccatccgtctgccacgctggctg
gacacccccaagttcaagtgtgggctcagcaagagctgcctgaacaacttcttcgcattt
aaaatcagcagtggagctgccaacgtagtgggtccctccatgtgctttgaagatgaaatt
atcatgagtcctgtgcgaaacaatgtgggcagaggcctgaacatcgctctggtgaacgga
actaccggacgtgtgataagaaaggccagctttgacatgtactctggagaaccccaaccc
ctgctggacttcctcacagaaattccagatagcaccctggtgctggtagcctcctatgat
gacccagggaccaaaatgaacgacaaaatcaagacgctcttcaccaacctggggagttcc
tacgccaagcagctgggcttccgggacagctgggtctttgtgggtgctaaagacctcagg
agtaaaagcccgtatgagcagttcttaaagaacaatccagagacaaacaaatatgaagga
tggccggagttactagaactggagggttgtgttccaaagaaagtaatgtag

DBGET integrated database retrieval system