KEGG   Rattus norvegicus (rat): 290221
Entry
290221            CDS       T01003                                 

Gene name
Nrl
Definition
(RefSeq) neural retina leucine zipper
  KO
K09038  neural retina-specific leucine zipper protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    290221 (Nrl)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    290221 (Nrl)
SSDB
Motif
Pfam: bZIP_Maf Maf_N KASH_CCD bZIP_1 APG6_N DivIC bZIP_2 DUF4164 DUF4407
Other DBs
NCBI-GeneID: 290221
NCBI-ProteinID: NP_001099506
RGD: 1305197
Ensembl: ENSRNOG00000018528
UniProt: D4ACF4
Position
15p13
AA seq 238 aa
MALPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVG
NSEAPRPAGLEELYWLATLQQQLGADEVLGLSPDEAVELLQSQGPVSVEGPHGYYSGSPG
ETGAPNVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSK
RLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL
NT seq 717 nt   +upstreamnt  +downstreamnt
atggctcttccccccagtcccttggctatggaatatgttaatgactttgacttgatgaag
tttgaaataaagcgggagccttctgagggccggtccggagtccccacagcctcactgggc
tctacaccgtacagttcagtgcctccctcacccaccttcagtgagccaggcatggtgggc
aacagcgaggcccctaggcccgcaggcctggaggagctatactggctggccaccctgcag
cagcagttgggggccgatgaggttctggggctgagtcctgatgaggctgtggaactactg
cagagccagggcccggtctctgtagaagggcctcatggctactattcagggagcccagga
gagacaggagccccgaatgtgcagttgcccgagagattttcagacgccgcgctggtctcg
atgtcggtgcgcgagttgaaccggcagctgcggggctgcgggcgcgacgaggctctgcgg
ctgaagcagaggcgccgcacgctcaagaaccgcggctacgcgcaggcctgtcgctccaag
cggctgcagcagcggcgcgggctggaggccgagcgcgcccgcctagccgcacagctggat
gccctacgggcggaggtggcccgcctggctcgagagcgcgacctctacaaggcccgctgt
gaccggctgacttccggtggccctgggtccgacgaccacacacacctcttcctctga

DBGET integrated database retrieval system