KEGG   Rattus norvegicus (rat): 290227
Entry
290227            CDS       T01003                                 

Gene name
Rec8, Rec8L1
Definition
(RefSeq) REC8 meiotic recombination protein
  KO
K13054  meiotic recombination protein REC8, animal type
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    290227 (Rec8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    290227 (Rec8)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Meiosis-specific sister chromatid cohesion proteins
   Cohesin complex
    290227 (Rec8)
SSDB
Motif
Pfam: Rad21_Rec8_N Rad21_Rec8 SMC_ScpA
Other DBs
NCBI-GeneID: 290227
NCBI-ProteinID: NP_001011916
RGD: 1309376
Ensembl: ENSRNOG00000019503
UniProt: Q6AYJ4
Position
15p13
AA seq 593 aa
MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLKVNVVKTCEEILNYVLVRVQPPMPGL
PRPRFSLYLSAQLQIGVIRVYFQQCQYLVEDIQHILEHLHRAQLRIRIDMEEADLPSLLL
PNCLAMMETLEDAPEPFFGTMSVDPTLPSPFDIPQIRHLLEAATPEKIREETLPEATPEP
RKPDRTLAMVQSPEVITLQEAEPIRMLRIEGEQDLPEISRGDLDLLIAEEDDAILLEERQ
RGRLLRQRRASPPLDESKEEPRALEGDGLVSSLSPPAPAQVEGIREPLPDQAFPPEVQKM
PGWEPGVLLTEVTPPQELRLPAPPSIEKRPPSPQRPPRRRRRGRQLLFWDKETQISREKF
EEQLQTGAHCCEYPVVQPPKRKLMSPAELFRTPTLSGWLSPELLALWTHCAQVPPRMLRQ
RPQLETEETVEEERVADKEERRKTEALSEIEVLREAQEPSGPLMLSSELSLEVAEEEKSR
TSFIPPEERWAWIEERQPEPPALPMLPELPEVPMEMPPGPELLSSEAVLRAVALELQANR
EPDFSSLVPPLSSRKLASRVFYLLLVLSAQKILLVDQQKPYGRLLIRLGPKFP
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgttctactatcccaacgtgcttcagcgccacacaggctgcttcgccactatctggctg
gccgctacccggggcagccgtttggtgaagcgggaatacctgaaagtgaacgtggtaaag
acctgcgaggaaatcctcaattatgtgctcgtacgagtgcaacctccgatgcctgggctg
ccccgcccccgcttctccctctatctctccgcccagcttcagattggtgtgataagggtc
tactttcaacagtgccagtaccttgtggaagacatccagcatatcctagagcacctacac
cgggcccagctgcggattcgcattgatatggaggaggctgacttacctagcttgcttctt
cccaattgcctggccatgatggagacgctggaggacgccccagaacccttttttgggacg
atgtctgtggaccctacacttcccagtccttttgatattcctcagattcgacacctttta
gaggctgcaaccccggagaaaattcgtgaggagacccttcctgaagccacgccggagccc
aggaagcctgacaggaccttggccatggtacagtcccctgaggtcatcaccttgcaggag
gcagagcccatccgaatgctgcggattgagggagagcaggatctcccagagatcagcaga
ggagacttagacctgctgatcgcagaggaagatgacgccatattgctggaggaacgtcag
agaggcagacttctccggcagcggagggcttccccaccactggatgaatccaaggaagag
ccccgggccctggaaggagatggtttggtctcctcactctcacctccagctcctgcacag
gttgaagggataagagaaccacttccagaccaggcctttccccctgaggtacagaagatg
ccaggctgggagcctggggtcctactcactgaggtgaccccacctcaggagctgcgtctg
cctgccccaccgagtatagagaagaggcccccgtctcctcagaggccacctcgccggcgc
cgccgggggcgccagttattgttctgggacaaggagacccagatctcccgggagaagttt
gaggaacagctgcagactggggctcactgctgcgagtatccagtggtccagcctcccaag
aggaagctcatgagcccagcggagctcttcagaaccccaactctctctggctggttatct
ccagaactactagctttatggacccattgtgcccaggttcccccaagaatgctcagacaa
aggccacagctggagactgaagagacagttgaggaagagagagtggcagacaaggaagaa
aggagaaagactgaagctctgagtgagattgaggttctgagagaggcccaggagcccagt
ggtcccctcatgttgtcttcagagctctccctagaagtagcagaagaagaaaaatctcga
actagcttcatccctccagaagaacggtgggcctggattgaggagaggcagccagagccc
cctgcactgcccatgctgcctgaacttcctgaagtgcccatggagatgcccccagggcct
gaactactctcttcagaggctgtgcttagggcagtggctctggagctgcaggctaacagg
gagcctgacttcagcagcctggtgccccctctcagctcccgaaagttggcttctcgggtc
ttctatctgctcttggtgctgtccgcacagaagatccttcttgtggaccaacagaagcca
tatgggcgcctcctgattcgtctaggacccaaattcccctga

DBGET integrated database retrieval system