KEGG   Rattus norvegicus (rat): 290284Help
Entry
290284            CDS       T01003                                 

Gene name
Sap18
Definition
(RefSeq) Sin3-associated polypeptide 18
  KO
K14324  histone deacetylase complex subunit SAP18
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    290284 (Sap18)
   03015 mRNA surveillance pathway
    290284 (Sap18)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     290284 (Sap18)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     290284 (Sap18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAP18
Motif
Other DBs
NCBI-GeneID: 290284
NCBI-ProteinID: NP_001028857
RGD: 1310388
Ensembl: ENSRNOG00000010732
UniProt: G3V7F6 Q3MHS8
Position
15p12
AA seq 172 aa AA seqDB search
MLAAGVGGQGERLPGRRRKMAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHH
RMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGY
RVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPSSGRMRPY
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccgcaggggtcggaggtcagggcgagcgtctcccgggccgaaggaggaagatg
gcggtggaatcgcgcgttacccaggaggaaattaagaaggagccggagaagccgatcgac
cgcgagaagacctgcccgctgctgctgcgggtcttcaccaccaacaacggccgccaccac
cgaatggacgagttctcccgcgggaacgtgccttcgagcgagctgcagatctacacctgg
atggatgcaaccttgaaagaactgactagtttagtaaaggaagtctacccagaagccaga
aagaagggcacgcacttcaattttgcaattgtttttatggatcttaaaagacctggatat
cgagttaaagagattggcagcaccatgtctggcaggaagggcactgatgactccatgacc
ctgcagtcacagaagttccaaataggggattatttggacatagccatcacgcctccaaat
cgggcaccaccttcgtcagggaggatgagaccgtactga

DBGET integrated database retrieval system