KEGG   Rattus norvegicus (rat): 290284
Entry
290284            CDS       T01003                                 

Gene name
Sap18
Definition
(RefSeq) histone deacetylase complex subunit SAP18
  KO
K14324  histone deacetylase complex subunit SAP18
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    290284 (Sap18)
   03015 mRNA surveillance pathway
    290284 (Sap18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    290284 (Sap18)
   03036 Chromosome and associated proteins [BR:rno03036]
    290284 (Sap18)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     290284 (Sap18)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     290284 (Sap18)
SSDB
Motif
Pfam: SAP18
Other DBs
NCBI-GeneID: 290284
NCBI-ProteinID: NP_001028857
RGD: 1310388
Ensembl: ENSRNOG00000010732
UniProt: G3V7F6 Q3MHS8
Position
15
AA seq 172 aa
MLAAGVGGQGERLPGRRRKMAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHH
RMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGY
RVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPSSGRMRPY
NT seq 519 nt   +upstreamnt  +downstreamnt
atgctcgccgcaggggtcggaggtcagggcgagcgtctcccgggccgaaggaggaagatg
gcggtggaatcgcgcgttacccaggaggaaattaagaaggagccggagaagccgatcgac
cgcgagaagacctgcccgctgctgctgcgggtcttcaccaccaacaacggccgccaccac
cgaatggacgagttctcccgcgggaacgtgccttcgagcgagctgcagatctacacctgg
atggatgcaaccttgaaagaactgactagtttagtaaaggaagtctacccagaagccaga
aagaagggcacgcacttcaattttgcaattgtttttatggatcttaaaagacctggatat
cgagttaaagagattggcagcaccatgtctggcaggaagggcactgatgactccatgacc
ctgcagtcacagaagttccaaataggggattatttggacatagccatcacgcctccaaat
cgggcaccaccttcgtcagggaggatgagaccgtactga

KEGG   Rattus norvegicus (rat): 498002
Entry
498002            CDS       T01003                                 

Gene name
RGD1561590
Definition
(RefSeq) histone deacetylase complex subunit SAP18
  KO
K14324  histone deacetylase complex subunit SAP18
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    498002 (RGD1561590)
   03015 mRNA surveillance pathway
    498002 (RGD1561590)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    498002 (RGD1561590)
   03036 Chromosome and associated proteins [BR:rno03036]
    498002 (RGD1561590)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     498002 (RGD1561590)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     498002 (RGD1561590)
SSDB
Motif
Pfam: SAP18
Other DBs
NCBI-GeneID: 498002
NCBI-ProteinID: XP_002727857
RGD: 1561590
Ensembl: ENSRNOG00000020771
UniProt: G3V7F6
Position
10
AA seq 172 aa
MLAAGVGGQGERLPGRRRKMAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHH
RMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGY
RVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPSSGRMRPY
NT seq 519 nt   +upstreamnt  +downstreamnt
atgctcgccgcaggggtcggaggtcagggcgagcgtctcccgggccgaaggaggaagatg
gcggtggaatcgcgcgttacccaggaggaaattaagaaggagccggagaagccgatcgac
cgcgagaagacctgcccgctgctgctgcgggtcttcaccaccaacaacggccgccaccac
cgaatggacgagttctcccgcgggaacgtgccttcgagcgagctgcagatctacacctgg
atggatgcaaccttgaaagaactgactagtttagtaaaggaagtctacccagaagccaga
aagaagggcacgcacttcaattttgcaattgtttttatggatcttaaaagacctggatat
cgagttaaagagattggcagcaccatgtctggcaggaagggcactgatgactccatgacc
ctgcagtcacagaagttccaaataggggattatttggacatagccatcacgcctccaaat
cgggcaccaccttcgtcagggaggatgagaccgtactga

DBGET integrated database retrieval system