KEGG   Rattus norvegicus (rat): 290291Help
Entry
290291            CDS       T01003                                 

Gene name
Cab39l
Definition
(RefSeq) calcium binding protein 39-like
  KO
K08272  calcium binding protein 39
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    290291 (Cab39l)
   04150 mTOR signaling pathway
    290291 (Cab39l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mo25 HEAT_2 CC2-LZ
Motif
Other DBs
NCBI-GeneID: 290291
NCBI-ProteinID: NP_001011917
RGD: 1308945
Ensembl: ENSRNOG00000011603
UniProt: Q5XIJ7
Position
15p12
AA seq 337 aa AA seqDB search
MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKELLCGAQDKE
PPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRCPTVEYIC
SHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKVILFSNQFRDFFKYVELSTFDIA
SDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRH
NFTIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPK
LIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKAAP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgcctttgtttagcaaatcacacaaaaatccagcagaaattgtcaaaatt
ctgaaagacaacctggccattttggaaaagcaggacaaaaagacagacaaggcttcagaa
gaagtgtcaaagtctctgcaagcgatgaaggagctcctgtgtggagcacaggacaaggag
ccccccacagaagcagtggctcagctggcacaggagctctatagcagcgggctgttggtg
acactcatagctgatctgcagctcatagactttgagggaaaaaaagatgtgacccagata
ttcaacaacatcctgagaagacagattggtacacggtgtcctacggtggaatatatctgt
tctcatcctcacatcctgtttatgcttctcaaaggctatgaagccccacagattgcctta
cgctgtgggattatgctaagagagtgcattcgccatgagccacttgccaaagtcatcctc
ttttctaatcagttcagagatttcttcaagtatgtggagctgtccacatttgatatcgct
tcagatgccttcgctacttttaaggatttattaaccagacataaagtgttggtagcagac
ttcttagaacaaaattatgatactatttttgaagactatgagaagctgctgcaatctgag
aactatgtgacaaagagacaatctttaaagttgctgggtgagctgatcctggaccgccac
aacttcaccattatgaccaaatatattagcaagccagagaacctgaaactcatgatgaac
ctgcttcgggacaaaagtccaaacatccagttcgaagccttccatgtctttaaggtgttt
gtggccagcccccataaaacgcagcctattgtggagatcctgttaaagaatcagcccaaa
ctcattgagtttctgagcagcttccagaaagaaaggacagatgatgagcagttcgctgat
gagaagaactacctgattaaacagattcgagacttgaagaaagcggccccatga

DBGET integrated database retrieval system