KEGG   Rattus norvegicus (rat): 290354
Entry
290354            CDS       T01003                                 

Gene name
Pdlim2
Definition
(RefSeq) PDZ and LIM domain protein 2
  KO
K23353  PDZ and LIM domain protein 1/2/3/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    290354 (Pdlim2)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 LIM domain-containing proteins
  PDZ-LIM family proteins
   290354 (Pdlim2)
SSDB
Motif
Pfam: PDZ DUF4749 PDZ_6 LIM PDZ_2
Other DBs
NCBI-GeneID: 290354
NCBI-ProteinID: NP_001007623
RGD: 1359203
Ensembl: ENSRNOG00000008543
UniProt: Q6AYD6
Position
15
AA seq 349 aa
MALTVNVVGPAPWGFRISGGRDFHTPIIVTKVTERGKAEAADLRPGDIIVAINGESAESM
LHAEAQSKIRQSASPLRLQLDRSQTASPGQINGEGSLDMLATRFQGSLRTHHNSQSSQRS
ACFSPASLSPRPDSPFSTPPPTSPIALSGENVIGCSFQSLTHSPGLAATHHLTYPGQPTS
QQAGHSSPSDSTVRVLLHSPGRPSSPRLSSLDLEEDSEVFKMLQENRQGRAAPRQSSSFR
LLQEALEAEERGGTPAFVPSSLSPKASLPTSRALATPPKLHTCEKCSVNISNQAVRIQEG
RYRHPGCYTCADCGLNLKMRGHFWVGNELYCEKHARQRYSMPGTLSSQA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggcgttgactgtgaatgtggtgggaccagcaccttggggcttccgcattagcggagga
agggatttccatacacccatcatcgtgacgaaggtcacagagaggggcaaggcggaggca
gctgatctccggcctggcgacatcattgtggccatcaatggagagagtgccgagagcatg
ctacatgcggaggcccaaagcaagatccgacagagtgcctcacccctaagactgcagctg
gaccggtcccaaactgcctctcctgggcagatcaatggggagggctccttggacatgctg
gcaactagattccagggctccctgaggacacaccataacagccagtcttcccagagatct
gcctgcttcagcccagcctctctcagtcccaggccagacagccctttctccactccaccc
cctaccagcccaattgccctttctggagagaatgtgattggctgtagtttccagagtctg
acacactctccaggtcttgctgctactcaccacttgacctaccctggccagcccaccagc
caacaggccggccacagcagcccaagcgactccacagtgagggtgctgcttcattcccca
ggacgaccctccagccccaggttaagcagtttggacctggaggaggactcagaggtgttc
aagatgctgcaggagaaccgccagggacgggctgccccaaggcagtccagctcttttcgg
ctcttacaggaagccttggaggctgaggaaagaggcggcacacctgcctttgtgcccagc
tcgctgagtcccaaggcttccttgcccacctccagggccttggccacgccacccaaactc
cacacctgtgagaagtgcagcgtcaacatctcgaaccaggcagtccgcatccaggagggg
aggtaccgacaccctggctgctacacctgtgcagactgcgggctgaacctgaagatgcgg
ggtcacttctgggtgggaaacgagttgtactgtgagaagcacgcccgccagcgctactca
atgcctggaactctcagctctcaagcctga

DBGET integrated database retrieval system