KEGG   Rattus norvegicus (rat): 290364Help
Entry
290364            CDS       T01003                                 

Gene name
Itm2b, Bri, imBRI2
Definition
(RefSeq) integral membrane protein 2B
  KO
K18264  integral membrane protein 2B
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    290364 (Itm2b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   290364 (Itm2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BRICHOS
Motif
Other DBs
NCBI-GeneID: 290364
NCBI-ProteinID: NP_001006964
RGD: 620727
Ensembl: ENSRNOG00000016271
UniProt: Q5XIE8
Position
15q11
AA seq 266 aa AA seqDB search
MVKVTFNSALAQKEAKKDEPKSSEEALIAPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFG
LAFMLAGVILGGAYLYKYFALQPDDVYYCGLKYIKDDVILSEPSADAPAARYQTIEENIK
IFEEDAVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNL
LELLINIKAGTYLPQSYLIHEHMVITDRIENVDHLGFFIYRLCHDKETYKLQRRETIRGI
QKREASNCFTIRHFENKFAVETLICS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggtgacgttcaactcggcgctggcccaaaaggaggccaagaaggacgagccc
aagagcagcgaggaggcgctcatcgcccctccggatgccgtggcggtggattgcaaggac
ccggatgacgtggtcccagttggccagaggagagcgtggtgttggtgcatgtgctttgga
ctggccttcatgctcgctggcgtcatcctgggaggagcatacctctacaagtattttgca
cttcagccagatgatgtgtactactgtggactaaagtacatcaaagatgacgtcatcttg
agtgagccttctgcagatgccccagctgctcgataccagacaattgaagagaatattaag
atctttgaggaagacgcagttgaattcatcagtgtgcctgtaccagagtttgcggacagc
gatcctgccaacattgtgcatgactttaacaagaaactcactgcttatttggaccttaat
ctggacaagtgctacgtgattcctctgaacacctccattgttatgccacccagaaacctg
ttggagcttcttattaacatcaaggccgggacctacttgcctcagtcatacctcatccat
gagcacatggtgatcaccgaccgcatcgaaaacgtggaccacctgggcttcttcatttac
cgactgtgtcacgacaaggaaacctacaaactgcagcgcagggaaaccattagaggtatt
cagaagcgtgaagccagtaactgtttcaccattcggcattttgagaacaaatttgctgtg
gaaactttaatttgttcttga

DBGET integrated database retrieval system